StarFunc result for job id Q8NDV3

User Input

>input (1235 residues)
MAHLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKN
IQELIHGAHIGKPISSSASVKIIYVEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAE
LEKIGIIVKAQNCLVFQGTVESISVKKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEE
DAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKKIHLLNT
KLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIK
AKENTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILH
KKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGN
LKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEFNEELNLI
RSELQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSVFGRLFDLCHPIHKKYQLAVTKVFGR
FITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKT
QFPQLKKVIQFVCGNGLVCETMEEARHIALSGPERQKTVALDGTLFLKSGVISGGSSDLK
YKARCWDEKELKNLRDRRSQKIQELKGLMKTLRKETDLKQIQTLIQGTQTRLKYSQNELE
MIKKKHLVAFYQEQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFQHF
CEEIGVENIREFENKHVKRQQEIDQKRYFYKKMLTRLNVQLEYSRSHLKKKLNKINTLKE
TIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLKDIRVTQNSSAEKVQTQIEEERKKFLA
VDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGSLDDIIEVEMGTEAE
STQATIDIYEKEEAFEIDYSSLKEDLKALQSDQEIEAHLRLLLQQVASQEDILLKTAAPN
LRALENLKTVRDKFQESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQI
YKKLCRNNSAQAFLSPENPEEPYLEGISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAV
HSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQFQMIVISLKEEFYSRADALIGIY
PEYDDCMFSRVLTLDLSQYPDTEGQESSKRHGESR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QCL7	0.348	0.344	0.000	1251	0.514	0.508	A0A2R8QCL7.pdb.gz
2	AFDB:O01789	0.551	0.542	0.000	1262	0.378	0.370	O01789.pdb.gz	SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans OX=6239 GN=him-1 PE=1 SV=4
3	AFDB:Q8AWB7	0.389	0.389	0.000	1234	0.525	0.525	Q8AWB7.pdb.gz	Q8AWB7_CHICK Structural maintenance of chromosomes protein OS=Gallus gallus OX=9031 GN=SMC1 PE=2 SV=2
4	AFDB:Q8NDV3	1.000	1.000	0.000	1235	1.000	1.000	Q8NDV3.pdb.gz	SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens OX=9606 GN=SMC1B PE=2 SV=3
5	AFDB:Q920F6	0.397	0.393	0.000	1248	0.825	0.817	Q920F6.pdb.gz	SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus OX=10090 GN=Smc1b PE=1 SV=1
6	AFDB:Q9N6I4	0.360	0.359	0.000	1238	0.401	0.400	Q9N6I4.pdb.gz	Q9N6I4_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC1 PE=2 SV=1
7	AFDB:Q6Q1P4	0.376	0.381	1.097E-92	1218	0.319	0.323	Q6Q1P4.pdb.gz	SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana OX=3702 GN=SMC1 PE=2 SV=2
8	AFDB:O94383	0.390	0.392	4.101E-92	1228	0.308	0.309	O94383.pdb.gz	SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psm1 PE=1 SV=2
9	AFDB:P32908	0.369	0.372	1.699E-79	1225	0.270	0.272	P32908.pdb.gz	SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC1 PE=1 SV=1
10	AFDB:Q38DK9	0.388	0.376	4.545E-77	1275	0.276	0.267	Q38DK9.pdb.gz	Q38DK9_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2970 PE=3 SV=1
11	PDB:6wg3A	0.309	0.667	1.147E-54	561	0.295	0.649	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
12	PDB:6yvuB	0.341	0.353	8.961E-51	1191	0.213	0.221	6yvuB.pdb.gz
13	PDB:6yvuA	0.237	0.253	2.391E-33	1127	0.195	0.214	6yvuA.pdb.gz
14	PDB:6wgeA	0.304	0.939	1.385E-28	390	0.207	0.656	6wgeA.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
15	PDB:7qcdA	0.267	0.313	1.539E-28	1028	0.131	0.158	7qcdA.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
16	PDB:7qcdB	0.267	0.319	2.075E-26	998	0.134	0.166	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
17	PDB:6wg3B	0.237	0.409	1.710E-25	693	0.138	0.247	6wg3B.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
18	PDB:7ogtA	0.145	0.213	2.470E-19	688	0.093	0.167	7ogtA.pdb.gz
19	PDB:7ogtB	0.137	0.218	2.036E-18	708	0.094	0.164	7ogtB.pdb.gz
20	PDB:6yufA	0.149	0.463	1.619E-16	384	0.070	0.227	6yufA.pdb.gz	A Structure-Based Mechanism for DNA Entry into the Cohesin Ring.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MR33	0.0	1298	1233	0.528	0.529	A0A384MR33_HUMAN Structural maintenance of chromosomes protein OS=Homo sapiens OX=9606 GN=SMC1L1 PE=2 SV=1
2	E7F0X6	0.0	1250	1232	0.530	0.531	E7F0X6_DANRE Structural maintenance of chromosomes protein OS=Danio rerio OX=7955 GN=smc1a PE=3 SV=1
3	G8JLG1	0.0	1236	1211	0.508	0.518	G8JLG1_HUMAN Structural maintenance of chromosomes protein OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2
4	O01789	0.0	828	1262	0.394	0.386	SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans OX=6239 GN=him-1 PE=1 SV=4
5	Q14683	0.0	1298	1233	0.528	0.529	SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2
6	Q6DRM9	0.0	1253	1233	0.530	0.531	Q6DRM9_DANRE Structural maintenance of chromosomes protein OS=Danio rerio OX=7955 GN=im:7158706 PE=1 SV=1
7	Q6Q1P4	0.0	588	1218	0.338	0.343	SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana OX=3702 GN=SMC1 PE=2 SV=2
8	Q8AWB7	0.0	1289	1234	0.523	0.524	Q8AWB7_CHICK Structural maintenance of chromosomes protein OS=Gallus gallus OX=9031 GN=SMC1 PE=2 SV=2
9	Q8NDV3	0.0	2511	1235	1.000	1.000	SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens OX=9606 GN=SMC1B PE=2 SV=3
10	Q920F6	0.0	2092	1248	0.828	0.819	SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus OX=10090 GN=Smc1b PE=1 SV=1
11	Q9CU62	0.0	1300	1233	0.529	0.530	SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus OX=10090 GN=Smc1a PE=1 SV=4
12	Q9N6I4	0.0	917	1238	0.405	0.404	Q9N6I4_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC1 PE=2 SV=1
13	Q9VCD8	0.0	919	1238	0.406	0.405	Q9VCD8_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC1 PE=1 SV=1
14	Q9Z1M9	0.0	1303	1233	0.530	0.530	SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus OX=10116 GN=Smc1a PE=1 SV=1
15	O94383	4.48e-179	563	1228	0.330	0.331	SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psm1 PE=1 SV=2
16	Q38DK9	1.44e-123	415	1275	0.299	0.289	Q38DK9_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2970 PE=3 SV=1
17	P32908	5.23e-119	401	1225	0.309	0.311	SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC1 PE=1 SV=1
18	V9GY57	2.04e-83	275	279	0.111	0.491	V9GY57_HUMAN Structural maintenance of chromosomes 1A (Fragment) OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=1
19	Q9FJL0	7.70e-67	249	1241	0.258	0.257	SMC4_ARATH Structural maintenance of chromosomes protein 4 OS=Arabidopsis thaliana OX=3702 GN=SMC4 PE=1 SV=1
20	Q8CG47	8.62e-65	243	1286	0.249	0.239	SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus OX=10090 GN=Smc4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	1.3e-05	36.5	AAA ATPase domain
2	PF13304 AAA_21	7.3e-06	37.6	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13555 AAA_29	0.052	24.6	P-loop containing region of AAA domain
4	PF07728 AAA_5	84	14.6	AAA domain (dynein-related subfamily)
5	PF00910 RNA_helicase	4.5e+02	12.6	RNA helicase
6	PF13558 SbcC_Walker_B	2.9e+02	13.2	SbcC/RAD50-like, Walker B motif
7	PF06470 SMC_hinge	3.2e-15	67.9	SMC proteins Flexible Hinge Domain
8	PF02463 SMC_N	4.7e-58	207.8	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350036

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000218089	0.999	Cohesin subunit SA-2
2	9606.ENSP00000297338	0.999	Double-strand-break repair protein rad21 homolog
3	9606.ENSP00000354720	0.999	Structural maintenance of chromosomes protein 3
4	9606.ENSP00000372689	0.999	Cohesin subunit SA-1
5	9606.ENSP00000477973	0.998	Cohesin subunit SA-3
6	9606.ENSP00000482546	0.998	Meiotic recombination protein REC8 homolog
7	9606.ENSP00000386414	0.997	Double-strand-break repair protein rad21-like protein 1
8	9606.ENSP00000257934	0.976	Separin
9	9606.ENSP00000282516	0.951	Nipped-B-like protein
10	9606.ENSP00000261597	0.949	Kinetochore protein NDC80 homolog
11	9606.ENSP00000350447	0.949	Shugoshin 2
12	9606.ENSP00000323421	0.939	Structural maintenance of chromosomes protein 1A
13	9606.ENSP00000286398	0.933	Structural maintenance of chromosomes protein 2
14	9606.ENSP00000303427	0.920	Sister chromatid cohesion protein PDS5 homolog A
15	9606.ENSP00000313851	0.895	Sister chromatid cohesion protein PDS5 homolog B
16	9606.ENSP00000350162	0.886	Synaptonemal complex protein 2
17	9606.ENSP00000358535	0.883	Synaptonemal complex protein 1
18	9606.ENSP00000376658	0.883	Synaptonemal complex protein 3
19	9606.ENSP00000293695	0.866	Synaptonemal complex central element protein 2
20	9606.ENSP00000354957	0.858	Structural maintenance of chromosomes protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.999	DNA binding
GO:0003824	0.673	catalytic activity
GO:0003690	0.427	double-stranded DNA binding
GO:0003682	0.378	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0016043	0.987	cellular component organization
GO:0007049	0.986	cell cycle
GO:0051276	0.983	chromosome organization
GO:0022402	0.974	cell cycle process
GO:0007062	0.866	sister chromatid cohesion
GO:0000003	0.627	reproduction
GO:0050789	0.512	regulation of biological process
GO:0022414	0.388	reproductive process
GO:0008152	0.369	metabolic process
GO:0071704	0.330	organic substance metabolic process
GO:0051321	0.327	meiotic cell cycle
GO:0044238	0.310	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005694	1.000	chromosome
GO:0005654	1.000	nucleoplasm
GO:0044815	0.981	DNA packaging complex
GO:0008278	0.974	cohesin complex
GO:0005829	0.963	cytosol
GO:0098687	0.879	chromosomal region
GO:0000228	0.484	nuclear chromosome
GO:0000794	0.381	condensed nuclear chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]