StarFunc result for job id Q8NDV7

User Input

>input (1962 residues)
MRELEAKATKDVERNLSRDLVQEEEQLMEEKKKKKDDKKKKEAAQKKATEQKIKVPEQIK
PSVSQPQPANSNNGTSTATSTNNNAKRATANNQQPQQQQQQQQPQQQQPQQQPQPQPQQQ
QPQQQPQALPRYPREVPPRFRHQEHKQLLKRGQHFPVIAANLGSAVKVLNSQSESSALTN
QQPQNNGEVQNSKNQSDINHSTSGSHYENSQRGPVSSTSDSSTNCKNAVVSDLSEKEAWP
SAPGSDPELASECMDADSASSSESERNITIMASGNTGGEKDGLRNSTGLGSQNKFVVGSS
SNNVGHGSSTGPWGFSHGAIISTCQVSVDAPESKSESSNNRMNAWGTVSSSSNGGLNPST
LNSASNHGAWPVLENNGLALKGPVGSGSSGINIQCSTIGQMPNNQSINSKVSGGSTHGTW
GSLQETCESEVSGTQKVSFSGQPQNITTEMTGPNNTTNFMTSSLPNSGSVQNNELPSSNT
GAWRVSTMNHPQMQAPSGMNGTSLSHLSNGESKSGGSYGTTWGAYGSNYSGDKCSGPNGQ
ANGDTVNATLMQPGVNGPMGTNFQVNTNKGGGVWESGAANSQSTSWGSGNGANSGGSRRG
WGTPAQNTGTNLPSVEWNKLPSNQHSNDSANGNGKTFTNGWKSTEEEDQGSATSQTNEQS
SVWAKTGGTVESDGSTESTGRLEEKGTGESQSRDRRKIDQHTLLQSIVNRTDLDPRVLSN
SGWGQTPIKQNTAWDTETSPRGERKTDNGTEAWGSSATQTFNSGACIDKTSPNGNDTSSV
SGWGDPKPALRWGDSKGSNCQGGWEDDSAATGMVKSNQWGNCKEEKAAWNDSQKNKQGWG
DGQKSSQGWSVSASDNWGETSRNNHWGEANKKSSSGGSDSDRSVSGWNELGKTSSFTWGN
NINPNNSSGWDESSKPTPSQGWGDPPKSNQSLGWGDSSKPVSSPDWNKQQDIVGSWGIPP
ATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVN
MWNKNVPNGNSRSDQQAQVHQLLTPASAISNKEASSGSGWGEPWGEPSTPATTVDNGTSA
WGKPIDSGPSWGEPIAAASSTSTWGSSSVGPQALSKSGPKSMQDGWCGDDMPLPGNRPTG
WEEEEDVEIGMWNSNSSQELNSSLNWPPYTKKMSSKGLSGKKRRRERGMMKGGNKQEEAW
INPFVKQFSNISFSRDSPEENVQSNKMDLSGGMLQDKRMEIDKHSLNIGDYNRTVGKGPG
SRPQISKESSMERNPYFDKDGIVADESQNMQFMSSQSMKLPPSNSALPNQALGSIAGLGM
QNLNSVRQNGNPSMFGVGNTAAQPRGMQQPPAQPLSSSQPNLRAQVPPPLLSPQVPVSLL
KYAPNNGGLNPLFGPQQVAMLNQLSQLNQLSQISQLQRLLAQQQRAQSQRSVPSGNRPQQ
DQQGRPLSVQQQMMQQSRQLDPNLLVKQQTPPSQQQPLHQPAMKSFLDNVMPHTTPELQK
GPSPINAFSNFPIGLNSNLNVNMDMNSIKEPQSRLRKWTTVDSISVNTSLDQNSSKHGAI
SSGFRLEESPFVPYDFMNSSTSPASPPGSIGDGWPRAKSPNGSSSVNWPPEFRPGEPWKG
YPNIDPETDPYVTPGSVINNLSINTVREVDHLRDRNSGSSSSLNTTLPSTSAWSSIRASN
YNVPLSSTAQSTSARNSDSKLTWSPGSVTNTSLAHELWKVPLPPKNITAPSRPPPGLTGQ
KPPLSTWDNSPLRIGGGWGNSDARYTPGSSWGESSSGRITNWLVLKNLTPQIDGSTLRTL
CMQHGPLITFHLNLPHGNALVRYSSKEEVVKAQKSLHMCVLGNTTILAEFASEEEISRFF
AQSQSLTPSPGWQSLGSSQSRLGSLDCSHSFSSRTDLNHWNGAGLSGTNCGDLHGTSLWG
TPHYSTSLWGPPSSSDPRGISSPSPINAFLSVDHLGGGGESM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UHK8	0.093	0.095	0.000	1896	0.916	0.948	Q3UHK8.pdb.gz	TNR6A_MOUSE Trinucleotide repeat-containing gene 6A protein OS=Mus musculus OX=10090 GN=Tnrc6a PE=1 SV=2
2	AFDB:Q8NDV7	1.000	1.000	0.000	1962	1.000	1.000	Q8NDV7.pdb.gz	TNR6A_HUMAN Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2
3	AFDB:Q9UPQ9	0.092	0.096	4.366E-66	1833	0.371	0.397	Q9UPQ9.pdb.gz	TNR6B_HUMAN Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4
4	AFDB:F1LV37	0.117	0.124	1.581E-62	1818	0.362	0.391	F1LV37.pdb.gz	F1LV37_RAT Trinucleotide repeat containing adaptor 6B OS=Rattus norvegicus OX=10116 GN=Tnrc6b PE=1 SV=3
5	AFDB:Q8SY33	0.054	0.068	5.153E-18	1384	0.152	0.215	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
6	AFDB:Q96EV2	0.047	0.077	6.661E-8	1170	0.091	0.153	Q96EV2.pdb.gz	RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3
7	AFDB:Q9UKV3	0.045	0.064	2.713E-6	1341	0.078	0.115	Q9UKV3.pdb.gz	ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2
8	AFDB:Q9JIX8	0.044	0.064	2.895E-6	1338	0.083	0.121	Q9JIX8.pdb.gz	ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus OX=10090 GN=Acin1 PE=1 SV=3
9	PDB:3lqvB	0.040	0.585	8.135E-6	115	0.008	0.130	3lqvB.pdb.gz	Branch Recognition by SF3b14
10	PDB:7r5jF0	0.043	0.299	1.664E-5	241	0.012	0.095	7r5jF0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
11	PDB:6y53o	0.036	0.396	3.630E-5	160	0.010	0.119	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
12	PDB:6ff7X	0.039	0.398	5.026E-5	171	0.009	0.099	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
13	PDB:6exnY	0.038	0.741	5.363E-5	87	0.009	0.195	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
14	PDB:7dvqY	0.037	0.474	5.363E-5	140	0.006	0.086	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:7oqcF	0.044	0.280	8.456E-5	267	0.006	0.045	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
16	PDB:5yzg1	0.036	0.281	1.249E-4	243	0.008	0.062	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
17	PDB:3pgwP	0.042	0.597	1.423E-4	113	0.008	0.142	3pgwP.pdb.gz
18	PDB:1hl6A	0.036	0.556	1.518E-4	119	0.008	0.126	1hl6A.pdb.gz
19	AFDB:D4AC33	0.028	0.029	3.047E-3	1920	0.128	0.131	D4AC33.pdb.gz	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
20	AFDB:Q9H2D6	0.043	0.038	5.471E-3	2365	0.160	0.133	Q9H2D6.pdb.gz	TARA_HUMAN TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZJ3	0.0	3357	1926	0.910	0.927	A0A0G2JZJ3_RAT Trinucleotide repeat containing adaptor 6A OS=Rattus norvegicus OX=10116 GN=Tnrc6a PE=1 SV=2
2	D3ZRA6	0.0	974	1901	0.436	0.450	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
3	F1LV37	0.0	619	1765	0.342	0.380	F1LV37_RAT Trinucleotide repeat containing adaptor 6B OS=Rattus norvegicus OX=10116 GN=Tnrc6b PE=1 SV=3
4	H7C269	0.0	1613	906	0.416	0.902	H7C269_HUMAN Trinucleotide repeat containing adaptor 6A (Fragment) OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=1
5	Q3UHC0	0.0	889	1690	0.379	0.440	TNR6C_MOUSE Trinucleotide repeat-containing gene 6C protein OS=Mus musculus OX=10090 GN=Tnrc6c PE=1 SV=2
6	Q3UHK8	0.0	3368	1896	0.915	0.947	TNR6A_MOUSE Trinucleotide repeat-containing gene 6A protein OS=Mus musculus OX=10090 GN=Tnrc6a PE=1 SV=2
7	Q8NDV7	0.0	3941	1962	1.000	1.000	TNR6A_HUMAN Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2
8	Q9HCJ0	0.0	897	1690	0.391	0.454	TNR6C_HUMAN Trinucleotide repeat-containing gene 6C protein OS=Homo sapiens OX=9606 GN=TNRC6C PE=1 SV=3
9	Q9UPQ9	0.0	812	1833	0.374	0.400	TNR6B_HUMAN Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4
10	Q8SY33	1.77e-35	150	1384	0.069	0.098	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
11	F4JW79	3.3	35.0	1493	0.033	0.043	RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana OX=3702 GN=RDM3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10427 Ago_hook	3.9e-19	81.2	Argonaute hook
2	PF00076 RRM_1	5.7	18.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16842 RRM_occluded	5e+02	12.0	Occluded RNA-recognition motif
4	PF16608 TNRC6-PABC_bdg	3.8e-121	415.7	TNRC6-PABC binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379144

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220592	0.999	Protein argonaute-2
2	9606.ENSP00000362300	0.999	Protein argonaute-1
3	9606.ENSP00000313007	0.998	Polyadenylate-binding protein 1
4	9606.ENSP00000320949	0.998	CCR4-NOT transcription complex subunit 1
5	9606.ENSP00000478754	0.996	Probable ATP-dependent RNA helicase DDX6
6	9606.ENSP00000437256	0.987	Endoribonuclease Dicer
7	9606.ENSP00000362287	0.986	Protein argonaute-3
8	9606.ENSP00000362306	0.981	Protein argonaute-4
9	9606.ENSP00000373715	0.978	m7GpppN-mRNA hydrolase
10	9606.ENSP00000273064	0.976	CCR4-NOT transcription complex subunit 9
11	9606.ENSP00000273317	0.976	LIM domain-containing protein 1
12	9606.ENSP00000351446	0.975	WD repeat-containing protein 5
13	9606.ENSP00000265351	0.968	Exportin-5
14	9606.ENSP00000266987	0.963	RISC-loading complex subunit TARBP2
15	9606.ENSP00000264515	0.955	Retinoblastoma-binding protein 5
16	9606.ENSP00000425561	0.948	Eukaryotic translation initiation factor 4E
17	9606.ENSP00000262189	0.932	Histone-lysine N-methyltransferase 2C
18	9606.ENSP00000398837	0.932	Histone-lysine N-methyltransferase 2B
19	9606.ENSP00000479618	0.931	Myc proto-oncogene protein
20	9606.ENSP00000356520	0.929	ATP-dependent RNA helicase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0010468	0.988	regulation of gene expression
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0048523	0.987	negative regulation of cellular process
GO:0010556	0.986	regulation of macromolecule biosynthetic process
GO:0031326	0.986	regulation of cellular biosynthetic process
GO:0010558	0.983	negative regulation of macromolecule biosynthetic process
GO:0031327	0.982	negative regulation of cellular biosynthetic process
GO:0010629	0.981	negative regulation of gene expression
GO:0010608	0.978	post-transcriptional regulation of gene expression
GO:0034248	0.977	regulation of amide metabolic process
GO:0051248	0.975	negative regulation of protein metabolic process
GO:2000112	0.974	regulation of cellular macromolecule biosynthetic process
GO:0006417	0.952	regulation of translation
GO:0017148	0.942	negative regulation of translation
GO:0031047	0.939	RNA-mediated gene silencing
GO:0016441	0.895	post-transcriptional gene silencing
GO:0050896	0.879	response to stimulus
GO:0035195	0.824	miRNA-mediated gene silencing
GO:0048518	0.798	positive regulation of biological process
GO:0009605	0.701	response to external stimulus
GO:0032502	0.689	developmental process
GO:0048522	0.677	positive regulation of cellular process
GO:0071496	0.594	cellular response to external stimulus
GO:0009893	0.585	positive regulation of metabolic process
GO:0051716	0.582	cellular response to stimulus
GO:0019219	0.582	regulation of nucleobase-containing compound metabolic process
GO:0048856	0.577	anatomical structure development
GO:0051252	0.567	regulation of RNA metabolic process
GO:0010604	0.565	positive regulation of macromolecule metabolic process
GO:0008152	0.497	metabolic process
GO:0007154	0.497	cell communication
GO:0031325	0.491	positive regulation of cellular metabolic process
GO:0071704	0.433	organic substance metabolic process
GO:0006950	0.427	response to stress
GO:0051173	0.427	positive regulation of nitrogen compound metabolic process
GO:0007492	0.407	endoderm development
GO:0009991	0.406	response to extracellular stimulus
GO:0043170	0.393	macromolecule metabolic process
GO:0044237	0.380	cellular metabolic process
GO:0044238	0.375	primary metabolic process
GO:0051254	0.375	positive regulation of RNA metabolic process
GO:0006807	0.371	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.987	nucleoplasm
GO:0032991	0.983	protein-containing complex
GO:0043232	0.942	intracellular non-membrane-bounded organelle
GO:0012505	0.885	endomembrane system
GO:1990904	0.740	ribonucleoprotein complex
GO:0035770	0.642	ribonucleoprotein granule
GO:0036464	0.634	cytoplasmic ribonucleoprotein granule
GO:0000932	0.622	P-body
GO:0016442	0.546	RISC complex
GO:0005794	0.397	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]