StarFunc result for job id Q8NDW8

User Input

>input (1320 residues)
MSSNDSSLMAGIIYYSQEKYFHHVQQAAAVGLEKFSNDPVLKFFKAYGVLKEEHIQDAIS
DLESIRHHPDVSLCSTMALIYAHKRCEIIDREAIQELEYSLKEIRKTVSGTALYYAGLFL
WLIGRHDKAKEYIDRMLKISRGFREAYVLRGWVDLTSDKPHTAKKAIEYLEQGIQDTKDV
LGLMGKAMYFMMQQNYSEALEVVNQITVTSGSFLPALVLKMQLFLARQDWEQTVEMGHRI
LEKDESNIDACQILTVHELAREGNMTTVSSLKTQKATNHVRNLIKALETREPENPSLHLK
KIIVVSRLCGSHQVILGLVCSFIERTFMATPSYVHVATELGYLFILKNQVKEALLWYSEA
MKLDKDGMAGLTGIILCHILEGHLEEAEYRLEFLKEVQKSLGKSEVLIFLQALLMSRKHK
GEEETTALLKEAVELHFSSMQGIPLGSEYFEKLDPYFLVCIAKEYLLFCPKQPRLPGQIV
SPLLKQVAVILNPVVKAAPALIDPLYLMAQVRYYSELENAQSILQRCLELDPASVDAHLL
MCQIYLAQGNFGMCFHCLELGVSHNFQVRDHPLYHLIKARALNKAGDYPEAIKTLKMVIK
LPALKKEEGRKFLRPSVQPSQRASILLELVEALRLNGELHEATKVMQDTINEFGGTPEEN
RITIANVDLVLSKGNVDVALNMLRNILPKQSCYMEAREKMANIYLQTLRDRRLYIRCYRE
LCEHLPGPHTSLLLGDALMSILEPEKALEVYDEAYRQNPHDASLASRIGHAYVKAHQYTE
AIEYYEAAQKINGQDFLCCDLGKLLLKLKKVNKAEKVLKQALEHDIVQDIPSMMNDVKCL
LLLAKVYKSHKKEAVIETLNKALDLQSRILKRVPLEQPEMIPSQKQLAASICIQFAEHYL
AEKEYDKAVQSYKDVFSYLPTDNKVMLELAQLYLLQGHLDLCEQHCAILLQTEQNHETAS
VLMADLMFRKQKHEAAINLYHQVLEKAPDNFLVLHKLIDLLRRSGKLEDIPAFFELAKKV
SSRVPLEPGFNYCRGIYCWHIGQPNEALKFLNKARKDSTWGQSAIYHMVQICLNPDNEVV
GGEAFENQGAESNYMEKKELEQQGVSTAEKLLREFYPHSDSSQTQLRLLQGLCRLATREK
ANMEAALGSFIQIAQAEKDSVPALLALAQAYVFLKQIPKARMQLKRLAKTPWVLSEAEDL
EKSWLLLADIYCQGSKFDLALELLRRCVQYNKSCYKAYEYMGFIMEKEQSYKDAVTNYKL
AWKYSHHANPAIGFKLAFNYLKDKKFVEAIEICNDVLREHPDYPKIREEILEKARRSLRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C0S4	0.788	0.791	0.000	1314	0.765	0.769	Q8C0S4.pdb.gz	TT21A_MOUSE Tetratricopeptide repeat protein 21A OS=Mus musculus OX=10090 GN=Ttc21a PE=1 SV=2
2	AFDB:Q8NDW8	1.000	1.000	0.000	1320	1.000	1.000	Q8NDW8.pdb.gz	TT21A_HUMAN Tetratricopeptide repeat protein 21A OS=Homo sapiens OX=9606 GN=TTC21A PE=1 SV=3
3	AFDB:Q7Z4L5	0.904	0.907	6.541E-93	1316	0.512	0.514	Q7Z4L5.pdb.gz	TT21B_HUMAN Tetratricopeptide repeat protein 21B OS=Homo sapiens OX=9606 GN=TTC21B PE=1 SV=2
4	AFDB:B0R0W1	0.914	0.913	3.664E-92	1321	0.514	0.513	B0R0W1.pdb.gz	B0R0W1_DANRE Tetratricopeptide repeat domain 21B OS=Danio rerio OX=7955 GN=sb:cb947 PE=1 SV=1
5	AFDB:Q0HA38	0.844	0.847	4.205E-92	1315	0.512	0.514	Q0HA38.pdb.gz	TT21B_MOUSE Tetratricopeptide repeat protein 21B OS=Mus musculus OX=10090 GN=Ttc21b PE=1 SV=1
6	AFDB:Q38EI1	0.727	0.713	8.181E-57	1351	0.275	0.269	Q38EI1.pdb.gz	Q38EI1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5670 PE=3 SV=1
7	AFDB:Q6PGP7	0.199	0.173	4.993E-20	1564	0.135	0.114	Q6PGP7.pdb.gz	SKI3_HUMAN Superkiller complex protein 3 OS=Homo sapiens OX=9606 GN=SKIC3 PE=1 SV=1
8	AFDB:Q6NNB2	0.239	0.251	1.274E-18	1233	0.130	0.139	Q6NNB2.pdb.gz	Q6NNB2_DROME LP07472p OS=Drosophila melanogaster OX=7227 GN=SKI3 PE=1 SV=1
9	AFDB:O94474	0.183	0.176	2.211E-18	1389	0.124	0.118	O94474.pdb.gz	SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ski3 PE=3 SV=1
10	AFDB:Q54HV0	0.206	0.160	4.588E-17	1825	0.139	0.101	Q54HV0.pdb.gz	Q54HV0_DICDI Tetratricopeptide-like helical domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1091 PE=4 SV=1
11	PDB:4bujB	0.188	0.184	9.799E-17	1367	0.131	0.127	4bujB.pdb.gz
12	PDB:7qdrB	0.277	0.296	2.952E-16	1212	0.137	0.149	7qdrB.pdb.gz
13	PDB:7dkhI	0.218	0.292	1.684E-12	914	0.089	0.129	7dkhI.pdb.gz
14	PDB:6tedQ	0.200	0.270	4.766E-11	890	0.092	0.137	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
15	PDB:7sqcR1	0.203	0.152	1.175E-9	2080	0.148	0.094	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:6bq1B	0.254	0.421	1.103E-8	728	0.082	0.148	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
17	PDB:7ntfA	0.172	0.227	1.915E-8	918	0.064	0.093	7ntfA.pdb.gz
18	PDB:6c95A	0.158	0.237	3.440E-8	773	0.093	0.159	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
19	PDB:5dseA	0.171	0.350	4.532E-8	537	0.077	0.188	5dseA.pdb.gz
20	PDB:8a3tJ	0.202	0.400	5.202E-8	509	0.059	0.153	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1Y2	0.0	2266	1143	0.839	0.969	A0A0B4J1Y2_HUMAN Tetratricopeptide repeat domain 21A OS=Homo sapiens OX=9606 GN=TTC21A PE=1 SV=1
2	A9XPA6	0.0	774	1355	0.358	0.349	A9XPA6_CHLRE Intraflagellar transport protein 139 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT139 PE=1 SV=1
3	B0R0W1	0.0	1399	1321	0.513	0.512	B0R0W1_DANRE Tetratricopeptide repeat domain 21B OS=Danio rerio OX=7955 GN=sb:cb947 PE=1 SV=1
4	Q0HA38	0.0	1365	1315	0.512	0.514	TT21B_MOUSE Tetratricopeptide repeat protein 21B OS=Mus musculus OX=10090 GN=Ttc21b PE=1 SV=1
5	Q7Z4L5	0.0	1397	1316	0.512	0.514	TT21B_HUMAN Tetratricopeptide repeat protein 21B OS=Homo sapiens OX=9606 GN=TTC21B PE=1 SV=2
6	Q8C0S4	0.0	2030	1314	0.767	0.770	TT21A_MOUSE Tetratricopeptide repeat protein 21A OS=Mus musculus OX=10090 GN=Ttc21a PE=1 SV=2
7	Q8NDW8	0.0	2722	1320	1.000	1.000	TT21A_HUMAN Tetratricopeptide repeat protein 21A OS=Homo sapiens OX=9606 GN=TTC21A PE=1 SV=3
8	Q38EI1	2.52e-149	489	1351	0.283	0.277	Q38EI1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5670 PE=3 SV=1
9	Q386Y0	0.002	45.1	800	0.050	0.083	Q386Y0_TRYB2 Intraflagellar transport protein IFT88, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0006 PE=4 SV=1
10	Q9FPW0	0.005	43.5	782	0.025	0.042	Q9FPW0_CHLRE Intraflagellar transport particle protein IFT88 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT88 PE=2 SV=1
11	Q9M8Y0	0.005	43.9	977	0.080	0.107	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
12	O77033	0.020	42.0	1390	0.042	0.040	CYC8_DICDI General transcriptional corepressor trfA OS=Dictyostelium discoideum OX=44689 GN=trfA PE=2 SV=1
13	Q0P4V8	0.021	41.6	832	0.026	0.041	Q0P4V8_XENTR Cell division cycle protein 27 homolog OS=Xenopus tropicalis OX=8364 GN=cdc27 PE=1 SV=1
14	Q96RK4	0.067	40.0	519	0.019	0.048	BBS4_HUMAN Bardet-Biedl syndrome 4 protein OS=Homo sapiens OX=9606 GN=BBS4 PE=1 SV=2
15	E7EXH4	0.11	39.3	528	0.020	0.049	E7EXH4_DANRE Bardet-Biedl syndrome 4 OS=Danio rerio OX=7955 GN=zgc:152964 PE=4 SV=1
16	Q01495	0.17	38.5	569	0.026	0.060	PEX5_PICAN Peroxisomal targeting signal receptor OS=Pichia angusta OX=870730 GN=PEX5 PE=1 SV=1
17	P73762	0.20	37.7	294	0.027	0.119	P73762_SYNY3 Sll0837 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll0837 PE=4 SV=1
18	Q9V9R6	0.21	38.5	840	0.016	0.025	Q9V9R6_DROME No mechanoreceptor potential B, isoform C OS=Drosophila melanogaster OX=7227 GN=nompB PE=4 SV=4
19	G5EA36	0.24	38.1	823	0.023	0.036	G5EA36_HUMAN Cell division cycle 27 OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=1
20	P30260	0.24	38.1	824	0.023	0.036	CDC27_HUMAN Cell division cycle protein 27 homolog OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	5.6e-14	63.5	Anaphase-promoting complex, cyclosome, subunit 3
2	PF20225 DUF6584	0.56	21.6	Family of unknown function (DUF6584)
3	PF14853 Fis1_TPR_C	5.6	18.5	Fis1 C-terminal tetratricopeptide repeat
4	PF11817 Foie-gras_1	1.4e+02	13.5	Foie gras liver health family 1
5	PF01535 PPR	0.56	21.6	PPR repeat
6	PF20308 TPR-S	1.4e+02	14.5	Tetratricopeptide Repeats-Sensor
7	PF00515 TPR_1	4.3e-16	69.2	Tetratricopeptide repeat
8	PF13374 TPR_10	3e+02	12.7	Tetratricopeptide repeat
9	PF13414 TPR_11	1.7e-13	61.3	TPR repeat
10	PF13424 TPR_12	5.7e-12	57.1	Tetratricopeptide repeat
11	PF13428 TPR_14	8.8e-32	118.0	Tetratricopeptide repeat
12	PF13429 TPR_15	8	17.3	Tetratricopeptide repeat
13	PF13432 TPR_16	4.1e-19	80.2	Tetratricopeptide repeat
14	PF13431 TPR_17	4e-06	37.9	Tetratricopeptide repeat
15	PF14559 TPR_19	1.6e-38	142.3	Tetratricopeptide repeat
16	PF07719 TPR_2	2.5e-26	100.7	Tetratricopeptide repeat
17	PF09976 TPR_21	23	16.2	Tetratricopeptide repeat-like domain
18	PF07721 TPR_4	1.7e+02	14.2	Tetratricopeptide repeat
19	PF13174 TPR_6	5.5e-08	44.1	Tetratricopeptide repeat
20	PF13176 TPR_7	0.0053	27.8	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398211

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000406012	0.880	Intraflagellar transport protein 140 homolog
2	9606.ENSP00000242591	0.849	Intraflagellar transport protein 81 homolog
3	9606.ENSP00000314444	0.831	WD repeat-containing protein 35
4	9606.ENSP00000404122	0.826	Intraflagellar transport protein 74 homolog
5	9606.ENSP00000382717	0.808	WD repeat-containing protein 19
6	9606.ENSP00000464443	0.781	Intraflagellar transport protein 20 homolog
7	9606.ENSP00000296266	0.776	Intraflagellar transport protein 122 homolog
8	9606.ENSP00000376417	0.753	Required for sperm flagellum axoneme organization and function (By similarity). Involved in axonemal central pair complex assembly and/or stability (By similarity).
9	9606.ENSP00000362121	0.743	Intraflagellar transport protein 52 homolog
10	9606.ENSP00000349568	0.738	Cilia and flagella associated protein 43
11	9606.ENSP00000312778	0.722	Intraflagellar transport protein 80 homolog
12	9606.ENSP00000389709	0.706	Probable E3 SUMO-protein ligase RNF212
13	9606.ENSP00000362424	0.685	TRAF3-interacting protein 1
14	9606.ENSP00000264020	0.684	Intraflagellar transport proteins
15	9606.ENSP00000238628	0.681	Intraflagellar transport proteins
16	9606.ENSP00000323580	0.673	Intraflagellar transport protein 88 homolog
17	9606.ENSP00000256246	0.669	Testis-expressed protein 15
18	9606.ENSP00000351646	0.658	Stress-induced-phosphoprotein 1
19	9606.ENSP00000371169	0.647	RNA 3'-terminal phosphate cyclase-like protein
20	9606.ENSP00000264538	0.642	Intraflagellar transport protein 57 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007018	0.987	microtubule-based movement
GO:0030317	0.968	flagellated sperm motility
GO:0007286	0.958	spermatid development
GO:0065007	0.557	biological regulation
GO:0050789	0.503	regulation of biological process
GO:0050794	0.422	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0032991	1.000	protein-containing complex
GO:0005575	1.000	cellular_component
GO:0043227	0.973	membrane-bounded organelle
GO:0030990	0.956	intraciliary transport particle
GO:0005622	0.931	intracellular anatomical structure
GO:0120025	0.896	plasma membrane bounded cell projection
GO:0005929	0.892	cilium
GO:0043229	0.739	intracellular organelle
GO:0005737	0.715	cytoplasm
GO:0097542	0.470	ciliary tip
GO:0043231	0.382	intracellular membrane-bounded organelle
GO:0030991	0.364	intraciliary transport particle A

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]