StarFunc result for job id Q8NDX1

User Input

>input (1056 residues)
MMGDYRLPDHPQPMEILNLYLGDSLEPHPGECPRETCSHEDPPEPFEEQTWATDPPEPTR
QNVPPWGSGVELTHLGSWVHQDGLEPCQEQTRATDPPESTRQDAPPWGSGVELTHLGSPS
AQREHRQNTASPGSPVNSHLPGSPKQNRSTSTQVVFWAGILQAQMCVLDLEEELEKTEGL
KAGLKCCLPTPPVDLPGDTGLHSSPPENEDSGEDSSEPEGEGQAWLREGTPDSSPQWGAE
EESMFFSNPLFLASPCSENSASGECFSWGASDSHAGVRTGPESPATLEPPLPEDTVLWEL
ESEPDLGDGAAISGHCTPPFPVPIYKPHSICWASVAAAEGAPAAPPGHGESEGDRLGPAP
SAAPCVDEALTWESGCVGSDLGPAAHPVQPWASLSPEGWQRGGPFWPQVTLNSQDRDERE
GGHPQESLPCTLAPCPWRSPASSPEPSSPESESRGPGPRPSPASSQEGSPQLQHHSSGIL
PKWTLDASQSSLLETDGEQPSSLKKKEAGEAPKPGEEVKSEGTARPAETGDVQPDIHLTS
AEHENLRTPMNSSWLPGSPMPQAQSPEEGQRPPAGDKLANGVRNNKVAWNLASRLYRLEG
FRKSEVAAYLQKNNDFSRAVAEEYLSFFQFGGQSLDRALRSFLQALVLSGETQERERILY
QFSRRFHHCNPGIFPSVDSVHTLTCAIMLLNTDLHGQNIGKSMSCQEFITNLNGLRDGGN
FPKELLKALYWSIRSEKLEWAVDEEDTARPEKAQPSLPAGKMSKPFLQLAQDPTVPTYKQ
GILARKMHQDADGKKTPWGKRGWKMFHTLLRGMVLYFLKQGEDHCLEGESLVGQMVDEPV
GVHHSLATPATHYTKKPHVFQLRTADWRLYLFQAPTAKEMSSWIARINLAAATHSAPPFP
AAVGSQRRFVRPILPVGPAQSSLEEQHRSHENCLDAAADDLLDLQRNLPERRGRGRELEE
HRLRKEYLEYEKTRYETYVQLLVARLHCPSDALDLWEEQLGREAGGTREPKLSLKKSHSS
PSLHQDEAPTTAKVKRNISERRTYRKIIPKRNRNQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NDX1	1.000	1.000	0.000	1056	1.000	1.000	Q8NDX1.pdb.gz	PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PSD4 PE=1 SV=2
2	PDB:6bbpA	0.148	0.296	1.141E-17	520	0.075	0.152	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
3	PDB:6u3eA	0.141	0.367	4.553E-17	397	0.077	0.204	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
4	AFDB:P91620	0.148	0.082	1.005E-10	2061	0.183	0.094	P91620.pdb.gz	SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
5	AFDB:P91621	0.146	0.079	1.434E-7	2072	0.155	0.079	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
6	AFDB:Q54DW4	0.094	0.076	8.405E-5	1350	0.131	0.102	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
7	PDB:3ljuX	0.085	0.223	3.587E-4	373	0.024	0.067	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
8	PDB:7rx9A	0.093	0.209	5.069E-4	432	0.043	0.104	7rx9A.pdb.gz
9	AFDB:Q6ZNL6	0.086	0.063	7.391E-4	1462	0.149	0.107	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
10	AFDB:M9PC26	0.103	0.061	1.153E-3	2021	0.147	0.077	M9PC26.pdb.gz	M9PC26_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG10020 PE=1 SV=1
11	PDB:4mt6A	0.089	0.226	1.234E-3	389	0.038	0.103	4mt6A.pdb.gz
12	AFDB:M9PHU7	0.075	0.065	3.592E-3	1248	0.120	0.102	M9PHU7.pdb.gz	M9PHU7_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG5741 PE=1 SV=1
13	AFDB:E9Q7D5	0.089	0.064	1.014E-2	1581	0.144	0.096	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
14	AFDB:X2JC00	0.084	0.064	1.065E-2	1404	0.120	0.090	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
15	AFDB:Q54L90	0.074	0.055	1.176E-2	1601	0.105	0.069	Q54L90.pdb.gz	GFLB_DICDI Ras guanine nucleotide exchange factor glfB OS=Dictyostelium discoideum OX=44689 GN=gflB PE=1 SV=1
16	PDB:4mk0A	0.082	0.132	5.540E-2	631	0.014	0.024	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:1k5dB	0.089	0.479	1.002E-1	146	0.010	0.075	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
18	PDB:5yqrA	0.081	0.284	1.053E-1	268	0.027	0.104	5yqrA.pdb.gz
19	PDB:6am0F	0.069	0.320	1.053E-1	178	0.014	0.084	6am0F.pdb.gz	Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
20	PDB:3pvuA	0.077	0.131	1.221E-1	609	0.032	0.056	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NDX1	0.0	2154	1056	1.000	1.000	PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PSD4 PE=1 SV=2
2	Q2PFD7	1.27e-150	477	1037	0.233	0.237	PSD3_MOUSE PH and SEC7 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Psd3 PE=1 SV=2
3	Q9ESQ7	6.49e-149	461	649	0.227	0.370	PSD1_RAT PH and SEC7 domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Psd PE=1 SV=1
4	A5PKW4	1.39e-147	469	1024	0.235	0.242	PSD1_HUMAN PH and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PSD PE=1 SV=2
5	A0A0R4IAG2	3.62e-144	454	837	0.225	0.284	A0A0R4IAG2_DANRE PH and SEC7 domain-containing protein 2 isoform X2 OS=Danio rerio OX=7955 GN=psd2 PE=4 SV=1
6	Q5DTT2	9.06e-144	459	1024	0.225	0.232	PSD1_MOUSE PH and SEC7 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Psd PE=1 SV=2
7	Q6P1I6	5.18e-142	446	770	0.225	0.309	PSD2_MOUSE PH and SEC7 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Psd2 PE=1 SV=1
8	E1JIT7	8.85e-114	388	1601	0.190	0.126	PSD_DROME PH and SEC7 domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Efa6 PE=1 SV=2
9	G5EET6	3.68e-69	250	818	0.142	0.183	EFA6_CAEEL Exchange factor for Arf-6 OS=Caenorhabditis elegans OX=6239 GN=efa-6 PE=1 SV=1
10	A0A2R8QK04	4.50e-28	120	396	0.090	0.240	A0A2R8QK04_DANRE Cytohesin 1a OS=Danio rerio OX=7955 GN=cyth3b PE=4 SV=1
11	F1QDR1	5.70e-28	119	394	0.090	0.241	F1QDR1_DANRE Cytohesin 1a OS=Danio rerio OX=7955 GN=cyth3b PE=4 SV=2
12	Q6PW01	9.25e-28	119	398	0.053	0.141	Q6PW01_DANRE Cytohesin 1-like protein OS=Danio rerio OX=7955 GN=cyth1 PE=2 SV=1
13	O08967	1.07e-27	119	399	0.053	0.140	CYH3_MOUSE Cytohesin-3 OS=Mus musculus OX=10090 GN=Cyth3 PE=1 SV=1
14	X1WHH8	1.21e-27	117	351	0.092	0.276	X1WHH8_DANRE Cytohesin 1a OS=Danio rerio OX=7955 GN=cyth3b PE=4 SV=1
15	Q6PC26	2.15e-27	118	399	0.090	0.238	Q6PC26_DANRE Cytohesin-1 OS=Danio rerio OX=7955 GN=zgc:73134 PE=2 SV=1
16	P97694	2.26e-27	118	398	0.094	0.249	CYH1_RAT Cytohesin-1 OS=Rattus norvegicus OX=10116 GN=Cyth1 PE=1 SV=1
17	Q9QX11	2.26e-27	118	398	0.094	0.249	CYH1_MOUSE Cytohesin-1 OS=Mus musculus OX=10090 GN=Cyth1 PE=1 SV=2
18	Q2KI41	1.23e-26	116	410	0.087	0.224	CYH2_BOVIN Cytohesin-2 OS=Bos taurus OX=9913 GN=CYTH2 PE=2 SV=1
19	Q15438	1.33e-26	115	398	0.107	0.284	CYH1_HUMAN Cytohesin-1 OS=Homo sapiens OX=9606 GN=CYTH1 PE=1 SV=1
20	E7F2Q0	2.09e-26	115	396	0.050	0.134	E7F2Q0_DANRE Cytohesin 3a OS=Danio rerio OX=7955 GN=cyth3a PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	7.2e-06	37.8	PH domain
2	PF15410 PH_9	1.7e-25	100.9	Pleckstrin homology domain
3	PF01369 Sec7	1.4e-36	137.4	Sec7 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245796

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347408	0.741	AP-3 complex subunit mu-1
2	9606.ENSP00000298316	0.731	ADP-ribosylation factor 6
3	9606.ENSP00000479504	0.706	Probable ATP-dependent RNA helicase DDX52
4	9606.ENSP00000366746	0.698	Signal transducing adapter molecule 1
5	9606.ENSP00000435582	0.696	Cytosolic carboxypeptidase 2
6	9606.ENSP00000323847	0.671	ADP-ribosylation factor-like protein 14
7	9606.ENSP00000300079	0.668	Glycine N-acyltransferase-like protein 1
8	9606.ENSP00000353458	0.663	Bromodomain adjacent to zinc finger domain protein 1A
9	9606.ENSP00000261889	0.655	Sorting nexin-1
10	9606.ENSP00000357879	0.623	26S proteasome non-ATPase regulatory subunit 4
11	9606.ENSP00000282026	0.584	ADP-ribosylation factor-like protein 11
12	9606.ENSP00000305204	0.572	Cytoskeleton-associated protein 2-like
13	9606.ENSP00000264380	0.508	1-phosphatidylinositol 3-phosphate 5-kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.975	biological regulation
GO:0050794	0.946	regulation of cellular process
GO:0071840	0.448	cellular component organization or biogenesis
GO:0016043	0.438	cellular component organization
GO:0051179	0.416	localization
GO:0032502	0.370	developmental process
GO:0023051	0.331	regulation of signaling
GO:0010646	0.331	regulation of cell communication
GO:0048856	0.321	anatomical structure development
GO:0051234	0.313	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0120025	0.995	plasma membrane bounded cell projection
GO:0031252	0.953	cell leading edge
GO:0098590	0.936	plasma membrane region
GO:0001726	0.928	ruffle
GO:0031253	0.911	cell projection membrane
GO:0031256	0.899	leading edge membrane
GO:0032587	0.833	ruffle membrane
GO:0005737	0.821	cytoplasm
GO:0043226	0.811	organelle
GO:0043231	0.801	intracellular membrane-bounded organelle
GO:0005829	0.723	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]