StarFunc result for job id Q8NDX6

User Input

>input (193 residues)
MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSD
KSRSRKDDDSLSEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHCFGAFRSSYHLKRHI
LIHTGEKPFECDICDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQ
GCQSKTSDGQFSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NDX6	1.000	1.000	1.663E-36	193	1.000	1.000	Q8NDX6.pdb.gz	ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens OX=9606 GN=ZNF740 PE=1 SV=1
2	AFDB:Q61624	0.229	0.070	8.604E-12	794	0.446	0.108	Q61624.pdb.gz	ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus OX=10090 GN=Znf148 PE=1 SV=2
3	AFDB:Q15552	0.216	0.109	9.186E-12	454	0.425	0.181	Q15552.pdb.gz	Q15552_HUMAN CACCC box-binding protein OS=Homo sapiens OX=9606 GN=tb protein PE=2 SV=1
4	AFDB:A0MS83	0.238	0.072	1.550E-11	808	0.383	0.092	A0MS83.pdb.gz	ZN148_DANRE Zinc finger protein 148 OS=Danio rerio OX=7955 GN=znf148 PE=2 SV=2
5	AFDB:Q9Y2X9	0.276	0.070	2.418E-10	895	0.415	0.089	Q9Y2X9.pdb.gz	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
6	AFDB:Q9UC06	0.398	0.176	5.301E-10	446	0.259	0.112	Q9UC06.pdb.gz	ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens OX=9606 GN=ZNF70 PE=2 SV=2
7	AFDB:Q12901	0.402	0.149	6.450E-10	538	0.244	0.087	Q12901.pdb.gz	ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens OX=9606 GN=ZNF155 PE=1 SV=4
8	AFDB:Q9JIC0	0.403	0.145	1.324E-9	545	0.269	0.095	Q9JIC0.pdb.gz	Q9JIC0_MOUSE KRAB zinc finger protein OS=Mus musculus OX=10090 GN=Zfp119a PE=2 SV=1
9	AFDB:Q96BV0	0.408	0.149	1.612E-9	537	0.254	0.091	Q96BV0.pdb.gz	ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens OX=9606 GN=ZNF775 PE=1 SV=2
10	AFDB:Q03936	0.392	0.131	2.093E-9	586	0.254	0.084	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
11	PDB:3w5kB	0.145	0.224	4.223E-3	110	0.150	0.264	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6htsR	0.119	0.287	2.110	72	0.052	0.139	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
13	PDB:3gn5A	0.095	0.129	2.926	132	0.036	0.053	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
14	PDB:5y58A	0.152	0.072	3.335	548	0.057	0.020	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
15	PDB:7ungi	0.104	0.083	4.332	250	0.119	0.092	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:6g1oA	0.071	0.037	6.008	486	0.036	0.014	6g1oA.pdb.gz	Gluconeogenic precursor availability regulates flux through the glyoxylate shunt inPseudomonas aeruginosa.
17	PDB:6yxxAf	0.097	0.127	6.848	139	0.052	0.072	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:5c8dE	0.068	0.053	7.805	280	0.026	0.018	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
19	PDB:6wkrA	0.133	0.062	8.333	439	0.047	0.021	6wkrA.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
20	PDB:6ydhA	0.066	0.184	8.333	62	0.041	0.129	6ydhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NDX6	5.69e-143	397	193	1.000	1.000	ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens OX=9606 GN=ZNF740 PE=1 SV=1
2	Q61624	5.02e-42	152	794	0.368	0.089	ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus OX=10090 GN=Znf148 PE=1 SV=2
3	Q62806	5.37e-42	152	794	0.368	0.089	ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus OX=10116 GN=Znf148 PE=1 SV=1
4	Q9UQR1	6.10e-42	151	794	0.368	0.089	ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148 PE=1 SV=2
5	A0MS83	1.26e-40	148	808	0.332	0.079	ZN148_DANRE Zinc finger protein 148 OS=Danio rerio OX=7955 GN=znf148 PE=2 SV=2
6	Q15552	3.15e-40	144	454	0.358	0.152	Q15552_HUMAN CACCC box-binding protein OS=Homo sapiens OX=9606 GN=tb protein PE=2 SV=1
7	Q99LI5	9.28e-36	134	893	0.378	0.082	ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus OX=10090 GN=Znf281 PE=1 SV=1
8	Q9Y2X9	8.90e-35	131	895	0.316	0.068	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
9	Q8IGP5	1.07e-19	88.2	566	0.202	0.069	Q8IGP5_DROME Chromatin-linked adaptor for MSL proteins, isoform B OS=Drosophila melanogaster OX=7227 GN=Clamp PE=1 SV=1
10	P17020	1.13e-19	88.2	682	0.218	0.062	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
11	Q9H4T2	1.45e-19	86.7	348	0.295	0.164	ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZSCAN16 PE=1 SV=2
12	P10073	2.73e-19	86.7	491	0.197	0.077	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
13	A0A1B0GR71	3.35e-19	86.7	966	0.207	0.041	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
14	Q6ECI4	4.35e-19	86.3	717	0.223	0.060	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
15	Q9UJW8	4.71e-19	86.3	692	0.202	0.056	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
16	Q9UII5	5.96e-19	85.9	783	0.212	0.052	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
17	Q8N9F8	8.02e-19	85.5	522	0.197	0.073	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2
18	Q9VRN4	1.03e-18	85.5	1203	0.218	0.035	Q9VRN4_DROME Blimp-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=2 SV=1
19	M9PBR0	1.09e-18	85.5	1216	0.218	0.035	M9PBR0_DROME Blimp-1, isoform B OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=4 SV=1
20	A6NNF4	1.17e-18	85.1	616	0.207	0.065	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	4.4e+02	12.7	BolA-like protein
2	PF15443 DUF4630	1.3e+02	14.2	Domain of unknown function (DUF4630)
3	PF00096 zf-C2H2	7.5e-07	40.4	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	4.7e-05	34.9	C2H2-type zinc finger
5	PF13465 zf-H2C2_2	9.5e-12	56.0	Zinc-finger double domain
6	PF12874 zf-met	9.9e+02	11.6	Zinc-finger of C2H2 type
7	PF17772 zf-MYST	3.5e+02	12.2	MYST family zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021503

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021462	0.681	Plays important functions in early cell signaling. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters.
2	61853.ENSNLEP00000004823	0.584	Phosphodiesterase 7A
3	61853.ENSNLEP00000009050	0.567	Transforming growth factor beta regulator 1
4	61853.ENSNLEP00000005955	0.562	Cold shock domain containing E1, RNA-binding
5	61853.ENSNLEP00000016856	0.559	Importin 13
6	61853.ENSNLEP00000019457	0.557	Dysbindin (dystrobrevin binding protein 1) domain containing 1
7	61853.ENSNLEP00000000301	0.552	Mediator of RNA polymerase II transcription subunit 13
8	61853.ENSNLEP00000024104	0.540	Uncharacterized protein
9	61853.ENSNLEP00000019998	0.526	Jun dimerization protein 2
10	61853.ENSNLEP00000000581	0.524	Serine palmitoyltransferase, long chain base subunit 1
11	61853.ENSNLEP00000014089	0.522	Receptor accessory protein 5
12	61853.ENSNLEP00000001026	0.515	Phosphodiesterase 6B, cGMP-specific, rod, beta
13	61853.ENSNLEP00000012855	0.512	DnaJ (Hsp40) homolog, subfamily C, member 5 beta
14	61853.ENSNLEP00000000863	0.508	ATPase family, AAA domain containing 2B
15	61853.ENSNLEP00000004233	0.508	Interferon gamma
16	61853.ENSNLEP00000014119	0.505	Solute carrier family 35, member F5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.999	sequence-specific DNA binding
GO:0003690	0.996	double-stranded DNA binding
GO:1990837	0.976	sequence-specific double-stranded DNA binding
GO:0140110	0.931	transcription regulator activity
GO:0003700	0.901	DNA-binding transcription factor activity
GO:0000981	0.484	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.422	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.950	regulation of biological process
GO:0009987	0.919	cellular process
GO:0050794	0.910	regulation of cellular process
GO:0032502	0.868	developmental process
GO:0032501	0.860	multicellular organismal process
GO:0048856	0.845	anatomical structure development
GO:0007275	0.742	multicellular organism development
GO:0019222	0.505	regulation of metabolic process
GO:0060255	0.435	regulation of macromolecule metabolic process
GO:0019219	0.406	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.390	regulation of gene expression
GO:0010556	0.390	regulation of macromolecule biosynthetic process
GO:0031326	0.390	regulation of cellular biosynthetic process
GO:0051252	0.384	regulation of RNA metabolic process
GO:0048519	0.339	negative regulation of biological process
GO:0006355	0.335	regulation of DNA-templated transcription
GO:0048523	0.313	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.655	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]