StarFunc result for job id Q8NDZ4

User Input

>input (430 residues)
MWRLVPPKLGRLSRSLKLAALGSLLVLMVLHSPSLLASWQRNELTDRRFLQLNKCPACFG
TSWCRRFLNGQVVFEAWGRLRLLDFLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQ
LDQSICKRATGRPRCDLLQAMPRTEFARLNGDVRLLTPEAVEGWSDLVHCPSQRLLDRLV
RRYAETKDSGSFLLRNLKDSERMQLLLTLAFNPEPLVLQSFPSDEGWPFAKYLGACGRMV
AVNYVGEELWSYFNAPWEKRVDLAWQLMEIAEQLTNNDFEFALYLLDVSFDNFAVGPRDG
KVIIVDAENVLVADKRLIRQNKPENWDVWYESKFDDCDKEACLSFSKEILCARATVDHNY
YAVCQNLLSRHATWRGTSGGLLHDPPSEIAKDGRLEALLDECANPKKRYGRFQAAKELRE
YLAQLSNNVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3USZ8	0.951	0.951	1.505E-72	430	0.977	0.977	Q3USZ8.pdb.gz	DIK2A_MOUSE Divergent protein kinase domain 2A OS=Mus musculus OX=10090 GN=Dipk2a PE=1 SV=2
2	AFDB:Q5VUD6	0.493	0.492	9.129E-9	431	0.170	0.169	Q5VUD6.pdb.gz	DIK1B_HUMAN Divergent protein kinase domain 1B OS=Homo sapiens OX=9606 GN=DIPK1B PE=1 SV=3
3	AFDB:Q504Y2	0.353	0.315	2.918E-4	493	0.114	0.099	Q504Y2.pdb.gz	PKDCC_HUMAN Extracellular tyrosine-protein kinase PKDCC OS=Homo sapiens OX=9606 GN=PKDCC PE=1 SV=2
4	AFDB:Q8GUH1	0.307	0.168	3.236E-4	834	0.081	0.042	Q8GUH1.pdb.gz	PUB33_ARATH U-box domain-containing protein 33 OS=Arabidopsis thaliana OX=3702 GN=PUB33 PE=2 SV=2
5	AFDB:E7F9N2	0.369	0.336	3.777E-4	481	0.144	0.129	E7F9N2.pdb.gz
6	AFDB:Q9LZF8	0.361	0.368	5.708E-4	420	0.091	0.093	Q9LZF8.pdb.gz	PCRK2_ARATH Serine/threonine-protein kinase PCRK2 OS=Arabidopsis thaliana OX=3702 GN=PCRK2 PE=1 SV=1
7	AFDB:Q9LSS0	0.359	0.247	6.664E-4	668	0.126	0.081	Q9LSS0.pdb.gz	LRK17_ARATH L-type lectin-domain containing receptor kinase I.7 OS=Arabidopsis thaliana OX=3702 GN=LECRK17 PE=2 SV=1
8	AFDB:Q9FKG5	0.316	0.182	1.007E-3	796	0.084	0.045	Q9FKG5.pdb.gz	PUB51_ARATH U-box domain-containing protein 51 OS=Arabidopsis thaliana OX=3702 GN=PUB51 PE=2 SV=2
9	AFDB:B5X4Z9	0.311	0.229	1.176E-3	617	0.077	0.053	B5X4Z9.pdb.gz	STU_ARATH Protein kinase STUNTED OS=Arabidopsis thaliana OX=3702 GN=STU PE=2 SV=1
10	AFDB:Q9M3D8	0.328	0.227	1.176E-3	664	0.137	0.089	Q9M3D8.pdb.gz	LRK13_ARATH L-type lectin-domain containing receptor kinase I.3 OS=Arabidopsis thaliana OX=3702 GN=LECRK13 PE=1 SV=1
11	PDB:1k9aB	0.307	0.300	2.548E-3	441	0.121	0.118	1k9aB.pdb.gz
12	PDB:6j5tH	0.321	0.404	2.975E-3	327	0.091	0.119	6j5tH.pdb.gz	Reconstitution and structure of a plant NLR resistosome conferring immunity.
13	PDB:5j0aB	0.251	0.332	1.198E-2	303	0.088	0.125	5j0aB.pdb.gz
14	PDB:1bi7A	0.194	0.291	1.262E-2	269	0.072	0.115	1bi7A.pdb.gz
15	PDB:4fi1A	0.280	0.318	1.262E-2	371	0.079	0.092	4fi1A.pdb.gz	Crystal structure of scCK2 alpha in complex with ATP
16	PDB:1blxA	0.246	0.331	1.399E-2	305	0.084	0.118	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
17	PDB:4fl2A	0.296	0.238	1.399E-2	555	0.081	0.063	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
18	PDB:6zxdz	0.239	0.337	1.551E-2	292	0.063	0.092	6zxdz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
19	PDB:5yk1A	0.253	0.269	2.736E-2	401	0.074	0.080	5yk1A.pdb.gz	Discovery of the first macrolide antibiotic binding protein in Mycobacterium tuberculosis: a new antibiotic resistance drug target.
20	PDB:2w96B	0.251	0.373	3.363E-2	267	0.079	0.127	2w96B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3USZ8	0.0	859	430	0.977	0.977	DIK2A_MOUSE Divergent protein kinase domain 2A OS=Mus musculus OX=10090 GN=Dipk2a PE=1 SV=2
2	Q8NDZ4	0.0	879	430	1.000	1.000	DIK2A_HUMAN Divergent protein kinase domain 2A OS=Homo sapiens OX=9606 GN=DIPK2A PE=1 SV=1
3	Q9FVS9	2.3	33.1	497	0.074	0.064	C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana OX=3702 GN=CYP96A15 PE=2 SV=1
4	P17031	5.5	32.0	533	0.037	0.030	ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens OX=9606 GN=ZNF26 PE=1 SV=3
5	P10287	6.4	31.6	822	0.051	0.027	CADH3_MOUSE Cadherin-3 OS=Mus musculus OX=10090 GN=Cdh3 PE=1 SV=2
6	Q587E1	8.5	31.2	624	0.077	0.053	Q587E1_TRYB2 Dynein heavy chain region D6 P-loop domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.180 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12260 PIP49_C	9.7e-53	190.1	Protein-kinase domain of FAM69

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010379607.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010355512.1	0.613	Solute carrier family 6 member 14
2	61622.XP_010382799.1	0.605	Belongs to the Ca(2+):cation antiporter (CaCA) (TC 2.A.19) family
3	61622.XP_010364460.1	0.588	MAGE family member F1
4	61622.XP_010376470.1	0.582	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
5	61622.XP_010355917.1	0.581	Nuclear RNA export factor 2
6	61622.XP_010387060.1	0.581	MAGE family member D2
7	61622.XP_010371753.1	0.571	NSE3 homolog, SMC5-SMC6 complex component
8	61622.XP_010357416.1	0.559	Protocadherin 18
9	61622.XP_010353883.1	0.556	Solute carrier family 7 member 5
10	61622.XP_010364720.1	0.548	Neuronal PAS domain-containing protein 4
11	61622.XP_010387418.1	0.545	Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family
12	61622.XP_010374567.1	0.543	Protocadherin 8
13	61622.XP_010382408.1	0.543	Solute carrier family 45 member 2
14	61622.XP_010361587.1	0.542	Protocadherin 10
15	61622.XP_010379605.1	0.532	Solute carrier family 9 member A9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.936	catalytic activity
GO:0016740	0.694	transferase activity
GO:0016772	0.661	transferase activity, transferring phosphorus-containing groups
GO:0016301	0.613	kinase activity
GO:0016773	0.524	phosphotransferase activity, alcohol group as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0051179	0.976	localization
GO:0006810	0.974	transport
GO:0065007	0.963	biological regulation
GO:0032501	0.945	multicellular organismal process
GO:0050789	0.925	regulation of biological process
GO:0019222	0.904	regulation of metabolic process
GO:0048518	0.901	positive regulation of biological process
GO:0050794	0.892	regulation of cellular process
GO:0032502	0.866	developmental process
GO:0023051	0.838	regulation of signaling
GO:0010646	0.838	regulation of cell communication
GO:0016192	0.836	vesicle-mediated transport
GO:0048856	0.827	anatomical structure development
GO:0007275	0.795	multicellular organism development
GO:0010656	0.780	negative regulation of muscle cell apoptotic process
GO:0048193	0.768	Golgi vesicle transport
GO:0009966	0.745	regulation of signal transduction
GO:0048731	0.737	system development
GO:0048522	0.731	positive regulation of cellular process
GO:0031323	0.712	regulation of cellular metabolic process
GO:0051641	0.695	cellular localization
GO:0035265	0.690	organ growth
GO:0008283	0.652	cell population proliferation
GO:0060419	0.642	heart growth
GO:0060255	0.637	regulation of macromolecule metabolic process
GO:1902531	0.634	regulation of intracellular signal transduction
GO:0051174	0.604	regulation of phosphorus metabolic process
GO:0051171	0.599	regulation of nitrogen compound metabolic process
GO:0033002	0.595	muscle cell proliferation
GO:0014066	0.586	regulation of phosphatidylinositol 3-kinase signaling
GO:0055017	0.586	cardiac muscle tissue growth
GO:0050790	0.572	regulation of catalytic activity
GO:0051640	0.556	organelle localization
GO:0051648	0.527	vesicle localization
GO:0051656	0.517	establishment of organelle localization
GO:0014855	0.502	striated muscle cell proliferation
GO:0051649	0.493	establishment of localization in cell
GO:0080090	0.480	regulation of primary metabolic process
GO:0060038	0.461	cardiac muscle cell proliferation
GO:0019220	0.458	regulation of phosphate metabolic process
GO:0051650	0.446	establishment of vesicle localization
GO:0010604	0.409	positive regulation of macromolecule metabolic process
GO:0051246	0.385	regulation of protein metabolic process
GO:0051173	0.368	positive regulation of nitrogen compound metabolic process
GO:0031325	0.340	positive regulation of cellular metabolic process
GO:0006903	0.302	vesicle targeting
GO:0042325	0.301	regulation of phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0030137	0.999	COPI-coated vesicle
GO:0012505	0.998	endomembrane system
GO:0016020	0.997	membrane
GO:0032991	0.995	protein-containing complex
GO:0031090	0.987	organelle membrane
GO:0098588	0.983	bounding membrane of organelle
GO:0005794	0.968	Golgi apparatus
GO:0030659	0.964	cytoplasmic vesicle membrane
GO:0098796	0.955	membrane protein complex
GO:0000139	0.954	Golgi membrane
GO:0048475	0.931	coated membrane
GO:0030660	0.931	Golgi-associated vesicle membrane
GO:0030126	0.902	COPI vesicle coat
GO:0005615	0.542	extracellular space
GO:0030133	0.438	transport vesicle
GO:0070013	0.387	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.694	Transferases.
EC:2.7.-.-	0.661	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.524	Phosphotransferases with an alcohol group as acceptor.

[back to server]