StarFunc result for job id Q8NE09

User Input

>input (1264 residues)
MPEKRLTAEPPTITEEEFEDSLATDDFLVDYFNEFLSLPTFSEAIRFNADYGVFEVANDA
PQFLEKQLKKILQNQQPRNPIYDVVRKGKNEVKPVQMNAPDEDETINVNYNIMCLSREEG
IKWIKKERLPAFLESDCYFEYRLAKLVSQVRWSKSGMNFTVGSNFSPWIVKKPPSLPPPA
TEEDNLVIMKKFYVSLGEASYTQTKDWFALAKQSQQTVSTFSLPCCVPYNKLKSPAISSV
SENFIFDDGVHPRTKKDPSKTNKLISEFEEEEGEEEEVSVSLQDTPSQALLRVYLEKKQD
VDESLTMHFSTCEEFLSSYIYFILRGAIQQIVGKPVGETPDYINFNNITKVSFDDCFESI
HGKNFLSELVQTTKERSEEIEQTSLSSKNESAGPESRADWCISHRTYDIGNRKEFERFKK
FIKGTLGERYWWLWMDIERLKVLKDPGRHQRHLEKMKKCYLVSNGDYYLSAEILSKFKLL
DGSQWNEEHLRNIQSEVLKPLLLYWAPRFCVTHSASTKYASAELKFWHLRQAKPRKDIDP
FPQMATLLPLRPKSCIPQIPEIQKEEFSLSQPPKSPNKSPEVKTATQKPWKRELLYPGSS
KDDVIEKGSKYMSESSKVIHLTSFTDISECLKPQLDRRYAYTEEPRVKTVSDVGALGGSD
MENLLQSLYVENRAGFFFTKFCEHSGNKLWKNSVYFWFDLQAYHQLFYQETLQPFKVCKQ
AQYLFATYVAPSATLDIGLQQEKKKEIYMKIQPPFEDLFDTAEEYILLLLLEPWTKMVKS
DQIAYKKVELVEETRQLDSTYFRKLQALHKETFSKKAEDTTCEIGTGILSLSNVSKRTEY
WDNVPAEYKHFKFSDLLNNKLEFEHFRQFLETHSSSMDLMCWTDIEQFRRITYRDRNQRK
AKSIYIKNKYLNKKYFFGPNSPASLYQQNQVMHLSGGWGKILHEQLDAPVLVEIQKHVQN
RLENVWLPLFLASEQFAARQKIKVQMKDIAEELLLQKAEKKIGVWKPVESKWISSSCKII
AFRKALLNPVTSRQFQRFVALKGDLLENGLLFWQEVQKYKDLCHSHCDESVIQKKITTII
NCFINSSIPPALQIDIPVEQAQKIIEHRKELGPYVFREAQMTIFGVLFKFWPQFCEFRKN
LTDENIMSVLERRQEYNKQKKKLAVLEDEKSGKDGIKQYANTSVPAIKTALLSDSFLGLQ
PYGRQPTWCYSKYIEALEQERILLKIQEELEKKLFAGLQPLTNFKASSSTMSLKKNMSAH
SSQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3UYX5	0.599	0.602	0.000	1258	0.757	0.761	G3UYX5.pdb.gz	RGS22_MOUSE Regulator of G-protein signaling 22 OS=Mus musculus OX=10090 GN=Rgs22 PE=1 SV=1
2	AFDB:Q8NE09	1.000	1.000	0.000	1264	1.000	1.000	Q8NE09.pdb.gz	RGS22_HUMAN Regulator of G-protein signaling 22 OS=Homo sapiens OX=9606 GN=RGS22 PE=1 SV=3
3	AFDB:P49796	0.080	0.084	2.742E-3	1198	0.064	0.068	P49796.pdb.gz	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
4	AFDB:E7F1U2	0.047	0.039	2.866E-3	1673	0.100	0.075	E7F1U2.pdb.gz	DNMBP_DANRE Dynamin-binding protein OS=Danio rerio OX=7955 GN=dnmbp PE=2 SV=1
5	PDB:6pjxA	0.079	0.176	6.775E-3	543	0.017	0.041	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
6	PDB:7shfC	0.090	0.253	1.052E-2	400	0.034	0.107	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
7	PDB:1agrE	0.086	0.743	1.254E-2	128	0.019	0.188	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
8	AFDB:Q9VCX1	0.085	0.071	2.584E-2	1541	0.059	0.049	Q9VCX1.pdb.gz	RGS_DROME Regulator of G-protein signaling loco OS=Drosophila melanogaster OX=7227 GN=loco PE=1 SV=2
9	AFDB:A0A1D8PTM6	0.042	0.053	2.949E-2	773	0.082	0.135	A0A1D8PTM6.pdb.gz	A0A1D8PTM6_CANAL Fgr32p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FGR32 PE=4 SV=1
10	PDB:4gouA	0.082	0.188	3.023E-2	507	0.036	0.089	4gouA.pdb.gz
11	AFDB:A0A2R8RRI1	0.047	0.094	3.839E-2	493	0.051	0.130	A0A2R8RRI1.pdb.gz	A0A2R8RRI1_DANRE Transcription factor EB OS=Danio rerio OX=7955 GN=tfeb PE=3 SV=1
12	AFDB:F1QAG9	0.083	0.181	4.783E-2	532	0.040	0.096	F1QAG9.pdb.gz
13	PDB:3c4wB	0.071	0.165	5.354E-2	519	0.019	0.046	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
14	AFDB:Q9D4H4	0.043	0.052	5.703E-2	968	0.109	0.143	Q9D4H4.pdb.gz	AMOL1_MOUSE Angiomotin-like protein 1 OS=Mus musculus OX=10090 GN=Amotl1 PE=1 SV=2
15	AFDB:Q9NZN5	0.064	0.054	7.106E-2	1544	0.097	0.080	Q9NZN5.pdb.gz	ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1
16	PDB:3pvuA	0.078	0.149	4.828E-1	609	0.023	0.048	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:3nynA	0.073	0.162	5.509E-1	554	0.018	0.042	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
18	PDB:4f52E	0.050	0.091	1.387	523	0.047	0.113	4f52E.pdb.gz	Structure of a Glomulin-RBX1-CUL1 Complex: Inhibition of a RING E3 Ligase through Masking of Its E2-Binding Surface.
19	PDB:1yviA	0.062	0.365	1.973	140	0.016	0.143	1yviA.pdb.gz
20	PDB:1wn0C	0.042	0.295	3.062	138	0.011	0.101	1wn0C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3UYX5	0.0	1942	1258	0.756	0.760	RGS22_MOUSE Regulator of G-protein signaling 22 OS=Mus musculus OX=10090 GN=Rgs22 PE=1 SV=1
2	G3V112	0.0	2204	1083	0.843	0.984	G3V112_HUMAN Regulator of G protein signaling 22 OS=Homo sapiens OX=9606 GN=RGS22 PE=1 SV=1
3	Q8NE09	0.0	2618	1264	1.000	1.000	RGS22_HUMAN Regulator of G-protein signaling 22 OS=Homo sapiens OX=9606 GN=RGS22 PE=1 SV=3
4	Q6DG95	0.011	40.8	172	0.028	0.203	Q6DG95_DANRE Regulator of G-protein signaling 2 OS=Danio rerio OX=7955 GN=rgs2 PE=2 SV=1
5	A0A5S9EHU3	0.79	34.7	147	0.013	0.116	A0A5S9EHU3_MOUSE Regulator of G protein Signaling 21 variant 2 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
6	A0A5S9EHU9	0.84	34.3	131	0.013	0.130	A0A5S9EHU9_MOUSE Regulator of G protein Signaling 21 variant 3 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
7	V9GXQ3	0.95	34.7	152	0.013	0.112	V9GXQ3_MOUSE Regulator of G protein Signaling 21 variant 1 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
8	Q8MQN8	1.1	36.2	1113	0.037	0.042	Q8MQN8_DROME chitin synthase OS=Drosophila melanogaster OX=7227 GN=kkv PE=2 SV=1
9	Q9I7P4	1.1	36.2	1615	0.033	0.026	Q9I7P4_DROME chitin synthase OS=Drosophila melanogaster OX=7227 GN=kkv PE=4 SV=3
10	Q8IPN4	1.2	36.2	1615	0.033	0.026	Q8IPN4_DROME chitin synthase OS=Drosophila melanogaster OX=7227 GN=kkv PE=4 SV=1
11	O54829	1.3	35.4	469	0.023	0.062	RGS7_MOUSE Regulator of G-protein signaling 7 OS=Mus musculus OX=10090 GN=Rgs7 PE=1 SV=2
12	Q6RT24	1.3	35.8	2474	0.021	0.011	CENPE_MOUSE Centromere-associated protein E OS=Mus musculus OX=10090 GN=Cenpe PE=1 SV=1
13	P49802	1.9	35.0	495	0.023	0.059	RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens OX=9606 GN=RGS7 PE=1 SV=3
14	P49803	2.1	35.0	477	0.023	0.061	RGS7_RAT Regulator of G-protein signaling 7 OS=Rattus norvegicus OX=10116 GN=Rgs7 PE=1 SV=2
15	Q09587	2.8	34.7	579	0.025	0.054	NHR22_CAEEL Nuclear hormone receptor family member nhr-22 OS=Caenorhabditis elegans OX=6239 GN=nhr-22 PE=1 SV=2
16	Q9CQE5	2.8	33.5	181	0.013	0.094	RGS10_MOUSE Regulator of G-protein signaling 10 OS=Mus musculus OX=10090 GN=Rgs10 PE=1 SV=1
17	B9VMQ4	3.0	34.7	809	0.017	0.027	B9VMQ4_APIME Neuroligin 1 OS=Apis mellifera OX=7460 PE=2 SV=1
18	Q7SXC7	3.2	34.3	532	0.022	0.053	Q7SXC7_DANRE Regulator of G-protein signaling 14 OS=Danio rerio OX=7955 GN=rgs14 PE=2 SV=1
19	Q9YGY0	3.4	34.3	842	0.026	0.039	AXIN1_XENLA Axin-1 OS=Xenopus laevis OX=8355 GN=axin1 PE=1 SV=1
20	Q9DCT8	3.6	33.5	208	0.013	0.077	CRIP2_MOUSE Cysteine-rich protein 2 OS=Mus musculus OX=10090 GN=Crip2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00615 RGS	1.9e-20	84.8	Regulator of G protein signaling domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354109

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312999	0.900	Guanine nucleotide-binding protein G(i) subunit alpha-2
2	9606.ENSP00000343027	0.900	Guanine nucleotide-binding protein G(i) subunit alpha-1
3	9606.ENSP00000358867	0.900	Guanine nucleotide-binding protein G(k) subunit alpha
4	9606.ENSP00000381339	0.900	Guanine nucleotide-binding protein G(t) subunit alpha-3
5	9606.ENSP00000331086	0.621	Outer dense fiber protein 4
6	9606.ENSP00000325313	0.613	Microtubule-associated protein 1S
7	9606.ENSP00000364212	0.580	Cytidine deaminase
8	9606.ENSP00000403293	0.570	F-box only protein 43
9	9606.ENSP00000377197	0.566	Hydrocephalus-inducing protein homolog
10	9606.ENSP00000297814	0.547	Kinesin-like protein KIF27
11	9606.ENSP00000367125	0.528	Probable G-protein coupled receptor 153
12	9606.ENSP00000328698	0.507	Ciliary-associated calcium-binding coiled-coil protein 1
13	9606.ENSP00000321386	0.505	F-box only protein 39

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001965	1.000	G-protein alpha-subunit binding
GO:0003824	0.423	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.974	biological regulation
GO:0050789	0.959	regulation of biological process
GO:0050794	0.910	regulation of cellular process
GO:0050896	0.827	response to stimulus
GO:0032501	0.564	multicellular organismal process
GO:0051716	0.425	cellular response to stimulus
GO:0007165	0.415	signal transduction
GO:0032502	0.341	developmental process
GO:0048856	0.329	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0070013	0.992	intracellular organelle lumen
GO:0031981	0.978	nuclear lumen
GO:0005856	0.930	cytoskeleton
GO:0005730	0.600	nucleolus
GO:0015629	0.453	actin cytoskeleton
GO:0001650	0.405	fibrillar center
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]