StarFunc result for job id Q8NE18

User Input

>input (718 residues)
MLNSTGELEFSNEEDPEIISQLTSLPLSGGKSSAGVPEKTGYPDSVYVMAANIFQGIRIE
KSAQKVLIKYGNEPLRSLSESEDQSFQRLSYELAFSALKYQDILETILIDSCIFPSTTIP
DHLSSLIIVMLYDFQDRKFQTRVLSDNEEPISEVQEVENLLNSFKIKLAAALARCRIKHD
ALSIYHILPETVRKQELRASTLPLYAWINTCKISPEEVYNNLKRRGYNKVKSVLHIDDKV
FAVDQHCYDVLIFPSHLKNDLINIDLFKDYKLIFQDKSRSLAVHSVKALLNMDDDVLMVN
TGSWYTVSHMSILTNNNTSKVFVCGVQSQAKDPDLKTLFTKIGCKNIEILHEKFINIESK
DHRLQKVKVILLLPRCSGLGVSNPVEFILNEHEDTEFLKDHSQGGISVDKLHVLAQQQYE
QLTHAMKFTKAQAVVYCTCSVFPEENEAVVKKALEFQDLGNKGQPYRLSPPVLPLCSLKE
IQLSTDKFFRMEPSEITNGCFLSILTRERDPSETVSVNDVLARAAAKGLLDGIELGKSSK
REKKKKKSKTSLTKGATTDNGIQMKIAEFLNRETKASANLSETVTKPPLPQKNTAQVGAS
SQTRKPNKLAPHPAVPAFVKNTCPSRPRERQTHFLRPRPEDRMVALKPIKIVLPPVFMPF
SSPQGIRSRMPTQHLYCRWVAPKALVPTCLPTHSLSRKEEKPKDDTPSSLLRPPRRWL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1sqfA	0.421	0.672	5.905E-15	425	0.111	0.188	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
2	PDB:7nacq	0.329	0.624	5.473E-13	358	0.093	0.187	7nacq.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
3	PDB:5zveB	0.307	0.546	9.816E-12	384	0.088	0.164	5zveB.pdb.gz	Archaeal NSUN6 catalyzes m5C72 modification on a wide-range of specific tRNAs.
4	PDB:3a4tA	0.307	0.784	2.527E-11	258	0.078	0.217	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.
5	PDB:2frxA	0.340	0.522	2.934E-11	455	0.086	0.136	2frxA.pdb.gz
6	PDB:5wwrA	0.323	0.481	1.110E-9	461	0.085	0.132	5wwrA.pdb.gz	Structural basis for substrate binding and catalytic mechanism of a human RNA:m5C methyltransferase NSun6
7	PDB:7of5C	0.279	0.533	2.312E-8	338	0.065	0.139	7of5C.pdb.gz	Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
8	PDB:3tkaA	0.186	0.413	6.985E-5	283	0.043	0.110	3tkaA.pdb.gz	Crystal and solution structures of methyltransferase RsmH provide basis for methylation of C1402 in 16S rRNA.
9	PDB:7r6kq	0.181	0.644	1.986E-4	177	0.042	0.169	7r6kq.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
10	PDB:3htxD	0.162	0.148	7.246E-4	795	0.035	0.031	3htxD.pdb.gz	Structural insights into mechanisms of the small RNA methyltransferase HEN1.
11	AFDB:P35612	0.071	0.070	2.958E-2	726	0.125	0.124	P35612.pdb.gz	ADDB_HUMAN Beta-adducin OS=Homo sapiens OX=9606 GN=ADD2 PE=1 SV=3
12	AFDB:F1R139	0.060	0.092	2.393E-1	386	0.058	0.109	F1R139.pdb.gz
13	AFDB:D4A0Y2	0.070	0.033	2.515E-1	2452	0.109	0.032	D4A0Y2.pdb.gz	D4A0Y2_RAT DOP1 leucine zipper like protein A OS=Rattus norvegicus OX=10116 GN=Dop1a PE=1 SV=3
14	AFDB:Q96AV8	0.102	0.087	4.136E-1	911	0.110	0.087	Q96AV8.pdb.gz	E2F7_HUMAN Transcription factor E2F7 OS=Homo sapiens OX=9606 GN=E2F7 PE=1 SV=3
15	AFDB:A0A096MK70	0.058	0.095	5.305E-1	291	0.035	0.086	A0A096MK70.pdb.gz	A0A096MK70_RAT Aspartate-beta-hydroxylase OS=Rattus norvegicus OX=10116 GN=Asph PE=1 SV=2
16	AFDB:Q52LR7	0.036	0.032	5.305E-1	807	0.064	0.057	Q52LR7.pdb.gz	EPC2_HUMAN Enhancer of polycomb homolog 2 OS=Homo sapiens OX=9606 GN=EPC2 PE=1 SV=2
17	AFDB:Q99PT9	0.064	0.051	5.305E-1	997	0.124	0.089	Q99PT9.pdb.gz	KIF19_MOUSE Kinesin-like protein KIF19 OS=Mus musculus OX=10090 GN=Kif19 PE=1 SV=2
18	AFDB:Q57YD1	0.075	0.082	6.160E-1	624	0.097	0.112	Q57YD1.pdb.gz	Q57YD1_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.90 PE=4 SV=1
19	AFDB:F4HUN4	0.121	0.088	6.804E-1	1175	0.099	0.060	F4HUN4.pdb.gz	F4HUN4_ARATH RAD3-like DNA-binding helicase protein OS=Arabidopsis thaliana OX=3702 GN=At1g20720 PE=1 SV=1
20	AFDB:K4DIA0	0.043	0.057	9.640E-1	473	0.054	0.082	K4DIA0.pdb.gz	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14AW5	0.0	953	724	0.681	0.675	NSUN7_MOUSE Putative methyltransferase NSUN7 OS=Mus musculus OX=10090 GN=Nsun7 PE=2 SV=2
2	Q8K4F6	2.74e-25	112	465	0.139	0.215	NSUN5_MOUSE 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nsun5 PE=1 SV=2
3	Q96P11	3.05e-25	111	429	0.146	0.245	NSUN5_HUMAN 28S rRNA (cytosine-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NSUN5 PE=1 SV=2
4	Q8GYE8	2.50e-20	97.8	567	0.149	0.189	NSUN5_ARATH 25S rRNA (cytosine-C(5))-methyltransferase NSUN5 OS=Arabidopsis thaliana OX=3702 GN=NSUN5 PE=1 SV=1
5	O14039	1.11e-13	76.3	460	0.102	0.159	RCM1_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase rcm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rcm1 PE=3 SV=3
6	Q9VDZ4	8.65e-11	67.0	433	0.109	0.180	NSUN5_DROME 28S rRNA (cytosine-C(5))-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Nsun5 PE=2 SV=1
7	Q9NAA7	3.10e-10	65.5	439	0.111	0.182	NSUN5_CAEEL 26S rRNA (cytosine-C(5))-methyltransferase nsun-5 OS=Caenorhabditis elegans OX=6239 GN=nsun-5 PE=1 SV=2
8	P53972	1.15e-07	57.4	490	0.097	0.143	RCM1_YEAST 25S rRNA (cytosine(2278)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RCM1 PE=1 SV=1
9	Q384A7	0.017	40.8	566	0.043	0.055	Q384A7_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0950 PE=3 SV=1
10	F4J117	0.059	39.3	591	0.042	0.051	LSF1_ARATH Phosphoglucan phosphatase LSF1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LSF1 PE=1 SV=1
11	Q9FG73	0.096	38.5	682	0.040	0.043	NOP2A_ARATH 25S rRNA (cytosine-C(5))-methyltransferase NOP2A OS=Arabidopsis thaliana OX=3702 GN=NOP2A PE=1 SV=1
12	Q8VYM6	0.20	37.4	671	0.043	0.046	NOP2B_ARATH 26S rRNA (cytosine-C(5))-methyltransferase NOP2B OS=Arabidopsis thaliana OX=3702 GN=NOP2B PE=1 SV=1
13	P46087	1.3	34.7	812	0.039	0.034	NOP2_HUMAN Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2
14	P36929	1.8	34.3	429	0.042	0.070	RSMB_ECOLI Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli (strain K12) OX=83333 GN=rsmB PE=1 SV=2
15	Q583H8	2.7	33.5	525	0.052	0.070	Q583H8_TRYB2 Nucleolar protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.90 PE=3 SV=1
16	E7F3F0	3.9	33.5	2286	0.026	0.008	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
17	Q60343	4.5	32.7	274	0.085	0.223	TRM4_METJA tRNA (cytosine(48)-C(5))-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=trm4 PE=1 SV=1
18	Q922K7	4.5	33.1	793	0.040	0.037	NOP2_MOUSE Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nop2 PE=1 SV=1
19	P38205	6.0	32.7	684	0.043	0.045	NCL1_YEAST Multisite-specific tRNA:(cytosine-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCL1 PE=1 SV=1
20	Q09690	6.1	32.7	1087	0.032	0.021	POM1_SCHPO DYRK-family kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pom1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01189 Methyltr_RsmB-F	1.4e-05	36.4	16S rRNA methyltransferase RsmB/F
2	PF00919 UPF0004	3.7e+02	12.6	Uncharacterized protein family UPF0004

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371201

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405068	0.834	Nucleolar protein 14
2	9606.ENSP00000264670	0.823	tRNA (cytosine(34)-C(5))-methyltransferase
3	9606.ENSP00000318986	0.821	tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial
4	9606.ENSP00000366519	0.808	Putative methyltransferase NSUN6
5	9606.ENSP00000371858	0.789	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
6	9606.ENSP00000419740	0.782	5-methylcytosine rRNA methyltransferase NSUN4
7	9606.ENSP00000421169	0.723	BEN domain containing 4
8	9606.ENSP00000273859	0.704	Probable phospholipid-transporting ATPase VD
9	9606.ENSP00000254940	0.696	60S ribosome subunit biogenesis protein NIP7 homolog
10	9606.ENSP00000384048	0.685	PAX-interacting protein 1
11	9606.ENSP00000252136	0.679	tRNA (uracil-5-)-methyltransferase homolog A
12	9606.ENSP00000385347	0.672	Transmembrane anterior posterior transformation protein 1 homolog
13	9606.ENSP00000367030	0.666	tRNA (cytosine(38)-C(5))-methyltransferase
14	9606.ENSP00000383516	0.642	Homeobox protein HMX1
15	9606.ENSP00000362027	0.632	tRNA (uracil(54)-C(5))-methyltransferase homolog
16	9606.ENSP00000344866	0.623	F-box/LRR-repeat protein 5
17	9606.ENSP00000354812	0.605	Putative methyltransferase C9orf114
18	9606.ENSP00000425261	0.600	Mitochondrial inner membrane protein COX18
19	9606.ENSP00000314441	0.599	tRNA (guanine-N(7)-)-methyltransferase
20	9606.ENSP00000354040	0.591	Nucleolar GTP-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0008173	0.999	RNA methyltransferase activity
GO:0140102	0.859	catalytic activity, acting on a rRNA
GO:0008649	0.851	rRNA methyltransferase activity
GO:0097159	0.776	organic cyclic compound binding
GO:0003676	0.770	nucleic acid binding
GO:0008169	0.766	C-methyltransferase activity
GO:0009383	0.721	rRNA (cytosine-C5-)-methyltransferase activity
GO:0003723	0.698	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071840	0.977	cellular component organization or biogenesis
GO:0006996	0.927	organelle organization
GO:0071704	0.796	organic substance metabolic process
GO:0044238	0.791	primary metabolic process
GO:0044237	0.788	cellular metabolic process
GO:0006807	0.773	nitrogen compound metabolic process
GO:0043170	0.748	macromolecule metabolic process
GO:0034641	0.681	cellular nitrogen compound metabolic process
GO:1901360	0.674	organic cyclic compound metabolic process
GO:0046483	0.673	heterocycle metabolic process
GO:0006725	0.672	cellular aromatic compound metabolic process
GO:0006139	0.590	nucleobase-containing compound metabolic process
GO:0090304	0.568	nucleic acid metabolic process
GO:0016070	0.520	RNA metabolic process
GO:0050789	0.503	regulation of biological process
GO:0010467	0.488	gene expression
GO:0050794	0.427	regulation of cellular process
GO:0007018	0.424	microtubule-based movement
GO:0030317	0.383	flagellated sperm motility
GO:0043412	0.376	macromolecule modification
GO:0007005	0.369	mitochondrion organization
GO:0044260	0.338	cellular macromolecule metabolic process
GO:0006396	0.338	RNA processing
GO:0009451	0.321	RNA modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0070013	0.999	intracellular organelle lumen
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005737	0.997	cytoplasm
GO:0005634	0.988	nucleus
GO:0005654	0.975	nucleoplasm
GO:0032991	0.889	protein-containing complex
GO:0005829	0.684	cytosol
GO:0005730	0.524	nucleolus
GO:1902494	0.305	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]