StarFunc result for job id Q8NE35

User Input

>input (698 residues)
MQDDLLMDKSKTQPQPQQQQRQQQQPQPESSVSEAPSTPLSSETPKPEENSAVPALSPAA
APPAPNGPDKMQMESPLLPGLSFHQPPQQPPPPQEPAAPGASLSPSFGSTWSTGTTNAVE
DSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQTQHHQQPPPPAPAPQPAQPAQ
PPQAQPPQQRRSPASPSQAPYAQRSAAAAYGHQPIMTSKPSSSSAVAAAAAAAAASSASS
SWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSNV
IAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTD
HEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNNAFLDDSHGDQAL
SSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSY
FPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMD
GSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSN
QQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQ
YYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TN99	0.375	0.366	8.937E-104	716	0.973	0.948	Q7TN99.pdb.gz	CPEB3_MOUSE Cytoplasmic polyadenylation element-binding protein 3 OS=Mus musculus OX=10090 GN=Cpeb3 PE=1 SV=1
2	AFDB:A0A0G2K3Y6	0.435	0.417	6.261E-69	729	0.580	0.556	A0A0G2K3Y6.pdb.gz	A0A0G2K3Y6_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
3	AFDB:D3ZHK8	0.374	0.364	3.561E-66	717	0.573	0.558	D3ZHK8.pdb.gz	D3ZHK8_RAT Cytoplasmic polyadenylation element binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cpeb2 PE=1 SV=4
4	PDB:6y53o	0.154	0.492	8.536E-8	160	0.050	0.219	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
5	PDB:7oqcF	0.101	0.244	7.073E-7	267	0.054	0.142	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
6	PDB:6y5qq	0.100	0.344	4.889E-6	178	0.042	0.163	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
7	PDB:5lsbA	0.095	0.341	8.421E-6	176	0.049	0.193	5lsbA.pdb.gz
8	PDB:7evoD	0.100	0.323	1.450E-5	200	0.042	0.145	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
9	PDB:5vsuA	0.107	0.185	7.411E-5	387	0.046	0.083	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
10	PDB:5yzg1	0.106	0.254	9.437E-5	243	0.052	0.148	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
11	PDB:6r5kH	0.104	0.174	1.727E-4	394	0.057	0.102	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
12	AFDB:A0A140UHY3	0.092	0.097	1.944E-4	661	0.107	0.113	A0A140UHY3.pdb.gz	A0A140UHY3_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
13	PDB:6ff7X	0.093	0.327	2.481E-4	171	0.052	0.211	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	AFDB:A0A0G2K850	0.089	0.095	3.779E-4	651	0.100	0.108	A0A0G2K850.pdb.gz	A0A0G2K850_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=2
15	AFDB:A0A0B4J1A5	0.091	0.100	4.265E-4	626	0.112	0.125	A0A0B4J1A5.pdb.gz	A0A0B4J1A5_DANRE EWS RNA-binding protein 1a OS=Danio rerio OX=7955 GN=EWSR1 PE=1 SV=1
16	AFDB:S4R1W5	0.096	0.063	4.813E-4	1118	0.120	0.075	S4R1W5.pdb.gz	S4R1W5_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
17	PDB:6g90B	0.111	0.379	6.523E-4	193	0.032	0.114	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
18	AFDB:Q8IXT5	0.099	0.071	7.803E-4	1001	0.112	0.078	Q8IXT5.pdb.gz	RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2
19	AFDB:P78332	0.096	0.063	2.948E-3	1123	0.142	0.088	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
20	AFDB:O60318	0.071	0.028	3.987E-3	1980	0.119	0.042	O60318.pdb.gz	GANP_HUMAN Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3Y6	0.0	714	729	0.585	0.560	A0A0G2K3Y6_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
2	A0A8I5Y6H1	0.0	1370	725	0.974	0.938	A0A8I5Y6H1_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=3 SV=1
3	A0A8I5ZK67	0.0	713	726	0.582	0.559	A0A8I5ZK67_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
4	A0A8I6A633	0.0	709	718	0.582	0.565	A0A8I6A633_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
5	A0A8I6GA10	0.0	1368	733	0.974	0.928	A0A8I6GA10_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=3 SV=1
6	D3ZKL3	0.0	716	721	0.583	0.564	D3ZKL3_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
7	D4AD99	0.0	1132	756	0.927	0.856	D4AD99_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=1 SV=3
8	Q17RY0	0.0	709	729	0.586	0.561	CPEB4_HUMAN Cytoplasmic polyadenylation element-binding protein 4 OS=Homo sapiens OX=9606 GN=CPEB4 PE=1 SV=1
9	Q28CH2	0.0	947	632	0.739	0.816	CPEB3_XENTR Cytoplasmic polyadenylation element-binding protein 3 OS=Xenopus tropicalis OX=8364 GN=cpeb3 PE=2 SV=1
10	Q5QP71	0.0	1361	684	0.966	0.985	Q5QP71_HUMAN Cytoplasmic polyadenylation element binding protein 3, isoform CRA_a OS=Homo sapiens OX=9606 GN=CPEB3 PE=2 SV=1
11	Q7TN98	0.0	714	729	0.587	0.562	CPEB4_MOUSE Cytoplasmic polyadenylation element-binding protein 4 OS=Mus musculus OX=10090 GN=Cpeb4 PE=1 SV=1
12	Q7TN99	0.0	1372	716	0.974	0.950	CPEB3_MOUSE Cytoplasmic polyadenylation element-binding protein 3 OS=Mus musculus OX=10090 GN=Cpeb3 PE=1 SV=1
13	Q7Z5Q1	0.0	686	589	0.501	0.594	CPEB2_HUMAN Cytoplasmic polyadenylation element-binding protein 2 OS=Homo sapiens OX=9606 GN=CPEB2 PE=2 SV=3
14	Q812E0	0.0	678	521	0.527	0.706	CPEB2_MOUSE Cytoplasmic polyadenylation element-binding protein 2 OS=Mus musculus OX=10090 GN=Cpeb2 PE=1 SV=1
15	Q8NE35	0.0	1433	698	1.000	1.000	CPEB3_HUMAN Cytoplasmic polyadenylation element-binding protein 3 OS=Homo sapiens OX=9606 GN=CPEB3 PE=1 SV=2
16	Q9VSR3	2.52e-171	509	704	0.327	0.324	ORB2_DROME Translational regulator orb2 OS=Drosophila melanogaster OX=7227 GN=orb2 PE=1 SV=1
17	Q03571	8.95e-88	288	560	0.195	0.243	CPB1_CAEEL Cytoplasmic polyadenylation element-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=cpb-1 PE=1 SV=3
18	A0A087X171	4.44e-63	221	561	0.165	0.205	A0A087X171_HUMAN Cytoplasmic polyadenylation element-binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
19	A0A087WXG7	8.64e-63	221	588	0.165	0.196	A0A087WXG7_HUMAN Cytoplasmic polyadenylation element binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
20	A4PES2	3.34e-61	216	566	0.166	0.205	A4PES2_PIG Cytoplasmic polyadenylation element binding protein 1 OS=Sus scrofa OX=9823 GN=CPEB1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16366 CEBP_ZZ	7e-18	75.9	Cytoplasmic polyadenylation element-binding protein ZZ domain
2	PF00076 RRM_1	8e-09	46.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	2.2e-32	122.4	RNA recognition motif
4	PF00643 zf-B_box	6.7e+02	11.9	B-box zinc finger
5	PF06220 zf-U1	1.4e+02	13.7	U1 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482128

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000427695	0.971	Protein Tob1
2	9606.ENSP00000355279	0.948	CCR4-NOT transcription complex subunit 7
3	9606.ENSP00000424896	0.924	CCR4-NOT transcription complex subunit 6-like
4	9606.ENSP00000377024	0.923	CCR4-NOT transcription complex subunit 6
5	9606.ENSP00000430493	0.916	CCR4-NOT transcription complex subunit 8
6	9606.ENSP00000320949	0.913	CCR4-NOT transcription complex subunit 1
7	9606.ENSP00000289382	0.911	CCR4-NOT transcription complex subunit 11
8	9606.ENSP00000351159	0.910	CCR4-NOT transcription complex subunit 3
9	9606.ENSP00000304077	0.907	Olfactory receptor 4K15
10	9606.ENSP00000229195	0.905	CCR4-NOT transcription complex subunit 2
11	9606.ENSP00000273064	0.905	CCR4-NOT transcription complex subunit 9
12	9606.ENSP00000399862	0.905	CCR4-NOT transcription complex subunit 10
13	9606.ENSP00000437271	0.900	182 kDa tankyrase-1-binding protein
14	9606.ENSP00000331305	0.837	Protein Tob2
15	9606.ENSP00000288207	0.818	G2/mitotic-specific cyclin-B2
16	9606.ENSP00000378699	0.816	Cyclin-dependent kinase 1
17	9606.ENSP00000216911	0.809	Aurora kinase A
18	9606.ENSP00000300093	0.804	Serine/threonine-protein kinase PLK1
19	9606.ENSP00000359506	0.735	Synaptic functional regulator FMR1
20	9606.ENSP00000477715	0.694	Cytoplasmic polyadenylation element-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008135	1.000	translation factor activity, RNA binding
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0000900	0.978	mRNA regulatory element binding translation repressor activity
GO:0035925	0.835	mRNA 3'-UTR AU-rich region binding
GO:0035613	0.768	RNA stem-loop binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0048519	0.989	negative regulation of biological process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0048523	0.969	negative regulation of cellular process
GO:0010468	0.963	regulation of gene expression
GO:0050896	0.956	response to stimulus
GO:0051246	0.938	regulation of protein metabolic process
GO:0010605	0.933	negative regulation of macromolecule metabolic process
GO:0006417	0.932	regulation of translation
GO:0048518	0.928	positive regulation of biological process
GO:0048522	0.921	positive regulation of cellular process
GO:0017148	0.920	negative regulation of translation
GO:0042221	0.916	response to chemical
GO:0010604	0.912	positive regulation of macromolecule metabolic process
GO:0031325	0.910	positive regulation of cellular metabolic process
GO:1903311	0.908	regulation of mRNA metabolic process
GO:0051716	0.894	cellular response to stimulus
GO:0065008	0.887	regulation of biological quality
GO:0051173	0.881	positive regulation of nitrogen compound metabolic process
GO:1901699	0.856	cellular response to nitrogen compound
GO:0009719	0.829	response to endogenous stimulus
GO:0010033	0.810	response to organic substance
GO:0001101	0.799	response to acid chemical
GO:0010243	0.794	response to organonitrogen compound
GO:0071495	0.778	cellular response to endogenous stimulus
GO:0071417	0.718	cellular response to organonitrogen compound
GO:1901700	0.691	response to oxygen-containing compound
GO:0071229	0.669	cellular response to acid chemical
GO:0043200	0.658	response to amino acid
GO:0071230	0.643	cellular response to amino acid stimulus
GO:0045935	0.566	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.525	positive regulation of RNA metabolic process
GO:0071704	0.506	organic substance metabolic process
GO:1903313	0.471	positive regulation of mRNA metabolic process
GO:0043170	0.420	macromolecule metabolic process
GO:0044237	0.415	cellular metabolic process
GO:0006807	0.400	nitrogen compound metabolic process
GO:0031329	0.344	regulation of cellular catabolic process
GO:0044238	0.335	primary metabolic process
GO:0061013	0.333	regulation of mRNA catabolic process
GO:0034641	0.305	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0016020	0.991	membrane
GO:0070013	0.967	intracellular organelle lumen
GO:0005829	0.966	cytosol
GO:0031981	0.963	nuclear lumen
GO:0005654	0.952	nucleoplasm
GO:0042995	0.926	cell projection
GO:0043005	0.911	neuron projection
GO:0071944	0.906	cell periphery
GO:0032991	0.845	protein-containing complex
GO:0036477	0.843	somatodendritic compartment
GO:0030425	0.823	dendrite
GO:0030054	0.742	cell junction
GO:0005886	0.731	plasma membrane
GO:0140535	0.588	intracellular protein-containing complex
GO:0045202	0.572	synapse
GO:0030014	0.439	CCR4-NOT complex
GO:0098794	0.386	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]