StarFunc result for job id Q8NE71

User Input

>input (845 residues)
MPKAPKQQPPEPEWIGDGESTSPSDKVVKKGKKDKKIKKTFFEELAVEDKQAGEEEKVLK
EKEQQQQQQQQQQKKKRDTRKGRRKKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKP
RGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKE
EKSKGKAKPQNKFAALDNEEEDKEEEIIKEKEPPKQGKEKAKKAEQGSEEEGEGEEEEEE
GGESKADDPYAHLSKKEKKKLKKQMEYERQVASLKAANAAENDFSVSQAEMSSRQAMLEN
ASDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNI
DVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAAERLEKVYEELR
ATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTN
HLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTFKKMY
QQKQKELLKQYEKQEKKLKELKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDEESQEAPE
LLKRPKEYTVRFTFPDPPPLSPPVLGLHGVTFGYQGQKPLFKNLDFGIDMDSRICIVGPN
GVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQ
DARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIESIDA
LGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMV
SRPRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2L6I2	0.684	0.716	0.000	807	0.950	0.995	Q2L6I2.pdb.gz	Q2L6I2_HUMAN ABC50 protein OS=Homo sapiens OX=9606 GN=ABCF1 PE=4 SV=1
2	AFDB:Q5STZ8	0.701	0.700	0.000	846	0.999	0.998	Q5STZ8.pdb.gz	Q5STZ8_HUMAN ATP binding cassette subfamily F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=10
3	AFDB:Q389P2	0.598	0.733	4.299E-65	684	0.299	0.370	Q389P2.pdb.gz	Q389P2_TRYB2 ATP-binding cassette protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.329.0040 PE=4 SV=1
4	AFDB:Q8K268	0.568	0.670	4.174E-64	709	0.299	0.357	Q8K268.pdb.gz	ABCF3_MOUSE ATP-binding cassette sub-family F member 3 OS=Mus musculus OX=10090 GN=Abcf3 PE=1 SV=1
5	AFDB:Q8T6B8	0.559	0.662	2.453E-61	708	0.290	0.346	Q8T6B8.pdb.gz	Q8T6B8_DICDI ABC transporter-related protein OS=Dictyostelium discoideum OX=44689 GN=abcF1 PE=4 SV=1
6	AFDB:Q20306	0.578	0.682	5.331E-61	712	0.302	0.358	Q20306.pdb.gz	Q20306_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abcf-3 PE=1 SV=1
7	AFDB:P43535	0.543	0.606	2.575E-57	752	0.253	0.285	P43535.pdb.gz	GCN20_YEAST Protein GCN20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN20 PE=1 SV=1
8	AFDB:P63389	0.555	0.729	1.503E-50	637	0.220	0.292	P63389.pdb.gz	YHES_ECOLI Probable ATP-binding protein YheS OS=Escherichia coli (strain K12) OX=83333 GN=yheS PE=1 SV=1
9	AFDB:P0A9U3	0.537	0.834	1.158E-43	530	0.188	0.300	P0A9U3.pdb.gz	YBIT_ECOLI Probable ATP-binding protein YbiT OS=Escherichia coli (strain K12) OX=83333 GN=ybiT PE=1 SV=1
10	AFDB:E0SKG8	0.538	0.833	1.804E-43	530	0.186	0.296	E0SKG8.pdb.gz	E0SKG8_DICD3 Fused predicted transporter subunits of ABC superfamily: ATP-binding components OS=Dickeya dadantii (strain 3937) OX=198628 GN=ybiT PE=4 SV=1
11	PDB:7msmx	0.453	0.655	2.037E-34	553	0.182	0.278	7msmx.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
12	PDB:2iw3B	0.227	0.197	3.344E-32	980	0.176	0.152	2iw3B.pdb.gz	Structure of Eef3 and the Mechanism of Transfer RNA Release from the E-Site.
13	PDB:3j5sD	0.436	0.625	2.973E-28	554	0.175	0.267	3j5sD.pdb.gz	EttA regulates translation by binding the ribosomal E site and restricting ribosome-tRNA dynamics.
14	PDB:4crmP	0.348	0.464	5.991E-16	608	0.122	0.169	4crmP.pdb.gz	Cryoelectron Microscopic Structures of Eukaryotic Translation Termination Complexes Containing Erf1-Erf3 or Erf1-Abce1.
15	PDB:6zmeCI	0.355	0.490	2.532E-15	582	0.112	0.163	6zmeCI.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
16	PDB:6qexA	0.308	0.238	2.677E-15	1182	0.147	0.105	6qexA.pdb.gz	Structural insight into substrate and inhibitor discrimination by human P-glycoprotein.
17	PDB:6tmfd	0.330	0.456	4.525E-14	582	0.109	0.158	6tmfd.pdb.gz	Molecular analysis of the ribosome recycling factor ABCE1 bound to the 30S post-splitting complex.
18	PDB:5w81A	0.371	0.277	6.311E-14	1173	0.122	0.088	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.
19	PDB:4m1mA	0.263	0.207	7.051E-14	1188	0.142	0.101	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
20	PDB:4f4cA	0.203	0.141	3.520E-13	1250	0.144	0.098	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1U9X609	0.0	1721	845	1.000	1.000	A0A1U9X609_HUMAN ABCF1 OS=Homo sapiens OX=9606 PE=4 SV=1
2	Q2L6I2	0.0	1364	807	0.955	1.000	Q2L6I2_HUMAN ABC50 protein OS=Homo sapiens OX=9606 GN=ABCF1 PE=4 SV=1
3	Q5STZ8	0.0	1717	846	1.000	0.999	Q5STZ8_HUMAN ATP binding cassette subfamily F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=10
4	Q6MG08	0.0	1270	839	0.903	0.909	ABCF1_RAT ATP-binding cassette sub-family F member 1 OS=Rattus norvegicus OX=10116 GN=Abcf1 PE=1 SV=1
5	Q8NE71	0.0	1721	845	1.000	1.000	ABCF1_HUMAN ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2
6	Q9M1H3	0.0	548	723	0.338	0.396	AB4F_ARATH ABC transporter F family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCF4 PE=2 SV=1
7	Q8T6B8	3.39e-158	480	708	0.292	0.349	Q8T6B8_DICDI ABC transporter-related protein OS=Dictyostelium discoideum OX=44689 GN=abcF1 PE=4 SV=1
8	Q8K268	8.63e-150	459	709	0.302	0.360	ABCF3_MOUSE ATP-binding cassette sub-family F member 3 OS=Mus musculus OX=10090 GN=Abcf3 PE=1 SV=1
9	Q9FJH6	3.63e-147	448	595	0.275	0.390	AB1F_ARATH ABC transporter F family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCF1 PE=2 SV=1
10	Q9NUQ8	7.35e-147	451	709	0.299	0.357	ABCF3_HUMAN ATP-binding cassette sub-family F member 3 OS=Homo sapiens OX=9606 GN=ABCF3 PE=1 SV=2
11	Q8H0V6	3.92e-146	449	715	0.276	0.326	AB3F_ARATH ABC transporter F family member 3 OS=Arabidopsis thaliana OX=3702 GN=ABCF3 PE=1 SV=1
12	Q20306	2.34e-143	442	712	0.293	0.348	Q20306_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abcf-3 PE=1 SV=1
13	Q389P2	1.29e-142	439	684	0.307	0.379	Q389P2_TRYB2 ATP-binding cassette protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.329.0040 PE=4 SV=1
14	O42943	1.40e-135	419	618	0.276	0.377	YBP8_SCHPO Uncharacterized ABC transporter ATP-binding protein C16H5.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16H5.08c PE=1 SV=1
15	Q8T6B4	2.27e-131	422	1142	0.270	0.200	ABCF4_DICDI ABC transporter F family member 4 OS=Dictyostelium discoideum OX=44689 GN=abcF4 PE=3 SV=1
16	Q99LE6	4.09e-131	407	628	0.272	0.366	ABCF2_MOUSE ATP-binding cassette sub-family F member 2 OS=Mus musculus OX=10090 GN=Abcf2 PE=1 SV=1
17	Q38BS9	1.18e-130	409	723	0.259	0.303	Q38BS9_TRYB2 ABC transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4330 PE=4 SV=1
18	Q9UG63	3.17e-130	405	623	0.273	0.371	ABCF2_HUMAN ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2
19	Q8T6B7	1.39e-129	402	593	0.259	0.369	ABCF2_DICDI ABC transporter F family member 2 OS=Dictyostelium discoideum OX=44689 GN=abcF2 PE=3 SV=1
20	P40024	5.20e-129	401	610	0.264	0.366	ARB1_YEAST ABC transporter ATP-binding protein ARB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	0.14	24.0	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	0.033	25.6	AAA domain
3	PF13191 AAA_16	0.012	27.4	AAA ATPase domain
4	PF13238 AAA_18	0.047	25.7	AAA domain
5	PF13304 AAA_21	5.5e-09	47.8	AAA domain, putative AbiEii toxin, Type IV TA system
6	PF13401 AAA_22	2.2	20.0	AAA domain
7	PF13476 AAA_23	6.7	18.7	AAA domain
8	PF13479 AAA_24	0.13	23.6	AAA domain
9	PF13481 AAA_25	9	17.3	AAA domain
10	PF13521 AAA_28	0.64	21.7	AAA domain
11	PF13555 AAA_29	0.01	26.9	P-loop containing region of AAA domain
12	PF13604 AAA_30	0.39	21.9	AAA domain
13	PF07728 AAA_5	0.86	21.1	AAA domain (dynein-related subfamily)
14	PF12775 AAA_7	1.3e+02	13.5	P-loop containing dynein motor region
15	PF00005 ABC_tran	5.7e-40	148.4	ABC transporter
16	PF12848 ABC_tran_Xtn	0.025	25.9	ABC transporter
17	PF00006 ATP-synt_ab	3.8e+02	12.1	ATP synthase alpha/beta family, nucleotide-binding domain
18	PF16575 CLP1_P	3.7e+02	12.3	mRNA cleavage and polyadenylation factor CLP1 P-loop
19	PF02492 cobW	6.7	17.7	CobW/HypB/UreG, nucleotide-binding domain
20	PF01926 MMR_HSR1	0.8	21.2	50S ribosome-binding GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313603

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296577	0.966	ATP-binding cassette sub-family E member 1
2	9606.ENSP00000363676	0.959	60S ribosomal protein L11
3	9606.ENSP00000472469	0.954	Ribosomal protein S28
4	9606.ENSP00000296674	0.949	40S ribosomal protein S23
5	9606.ENSP00000363018	0.943	60S ribosomal protein L10a
6	9606.ENSP00000262584	0.941	60S ribosomal protein L8
7	9606.ENSP00000379339	0.938	Ribosomal protein S29
8	9606.ENSP00000225430	0.936	Ribosomal protein L19
9	9606.ENSP00000309830	0.931	Ribosomal protein L38
10	9606.ENSP00000356520	0.928	ATP-dependent RNA helicase A
11	9606.ENSP00000222247	0.926	Belongs to the eukaryotic ribosomal protein eL20 family.
12	9606.ENSP00000403172	0.926	60S ribosomal protein L6
13	9606.ENSP00000428085	0.925	Ribosomal protein L30
14	9606.ENSP00000377640	0.924	Ribosomal protein L24
15	9606.ENSP00000447001	0.924	60S ribosomal protein L18
16	9606.ENSP00000464342	0.924	60S ribosomal protein L36
17	9606.ENSP00000345957	0.923	Ribosomal protein S21
18	9606.ENSP00000416429	0.923	Ribosomal protein L32
19	9606.ENSP00000348849	0.922	Ribosomal protein S26
20	9606.ENSP00000355315	0.921	Ribosomal protein L39

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.997	RNA binding
GO:0035639	0.997	purine ribonucleoside triphosphate binding
GO:0032555	0.997	purine ribonucleotide binding
GO:0044877	0.996	protein-containing complex binding
GO:0005524	0.992	ATP binding
GO:0008135	0.991	translation factor activity, RNA binding
GO:0043022	0.985	ribosome binding
GO:0008494	0.971	translation activator activity
GO:0003824	0.708	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0044238	0.987	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0010467	0.978	gene expression
GO:0010608	0.977	post-transcriptional regulation of gene expression
GO:0006518	0.975	peptide metabolic process
GO:0044260	0.969	cellular macromolecule metabolic process
GO:0044271	0.968	cellular nitrogen compound biosynthetic process
GO:0009059	0.966	macromolecule biosynthetic process
GO:0019538	0.966	protein metabolic process
GO:0050896	0.965	response to stimulus
GO:0080090	0.965	regulation of primary metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0031323	0.963	regulation of cellular metabolic process
GO:0006412	0.962	translation
GO:0009889	0.957	regulation of biosynthetic process
GO:0010556	0.947	regulation of macromolecule biosynthetic process
GO:0031326	0.946	regulation of cellular biosynthetic process
GO:0051246	0.907	regulation of protein metabolic process
GO:0006413	0.892	translational initiation
GO:0006417	0.862	regulation of translation
GO:0048518	0.780	positive regulation of biological process
GO:0048522	0.665	positive regulation of cellular process
GO:0045727	0.520	positive regulation of translation
GO:0006950	0.381	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043232	0.924	intracellular non-membrane-bounded organelle
GO:0032991	0.468	protein-containing complex
GO:0043231	0.433	intracellular membrane-bounded organelle
GO:0070013	0.416	intracellular organelle lumen
GO:0005634	0.359	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]