StarFunc result for job id Q8NE86

User Input

>input (351 residues)
MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQN
LGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDR
GIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVK
TLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGL
AYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYL
LFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NE86	1.000	1.000	4.995E-57	351	1.000	1.000	Q8NE86.pdb.gz	MCU_HUMAN Calcium uniporter protein, mitochondrial OS=Homo sapiens OX=9606 GN=MCU PE=1 SV=1
2	AFDB:Q08BI9	0.783	0.732	3.745E-43	376	0.692	0.646	Q08BI9.pdb.gz	MCU_DANRE Calcium uniporter protein, mitochondrial OS=Danio rerio OX=7955 GN=mcu PE=1 SV=1
3	PDB:6o58A	0.716	0.907	1.904E-38	273	0.778	1.000	6o58A.pdb.gz
4	AFDB:Q8IQ70	0.452	0.434	3.526E-32	366	0.416	0.399	Q8IQ70.pdb.gz	MCU_DROME Calcium uniporter protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MCU PE=1 SV=2
5	AFDB:Q9NWR8	0.596	0.619	7.662E-31	336	0.410	0.429	Q9NWR8.pdb.gz	MCUB_HUMAN Calcium uniporter regulatory subunit MCUb, mitochondrial OS=Homo sapiens OX=9606 GN=MCUB PE=1 SV=2
6	AFDB:Q21121	0.430	0.452	9.870E-30	333	0.353	0.372	Q21121.pdb.gz	MCU_CAEEL Calcium uniporter protein, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mcu-1 PE=1 SV=2
7	AFDB:Q810S1	0.583	0.593	2.500E-29	345	0.396	0.403	Q810S1.pdb.gz	MCUB_MOUSE Calcium uniporter regulatory subunit MCUb, mitochondrial OS=Mus musculus OX=10090 GN=Mcub PE=1 SV=1
8	AFDB:E9DVV4	0.338	0.251	2.081E-10	484	0.185	0.134	E9DVV4.pdb.gz	E9DVV4_METAQ Calcium uniporter protein OS=Metarhizium acridum (strain CQMa 102) OX=655827 GN=MAC_01752 PE=1 SV=1
9	AFDB:Q7S4I4	0.342	0.251	6.275E-10	493	0.182	0.130	Q7S4I4.pdb.gz	Q7S4I4_NEUCR Calcium uniporter protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU08166 PE=1 SV=1
10	AFDB:W2SDE2	0.346	0.350	3.585E-9	346	0.140	0.142	W2SDE2.pdb.gz	W2SDE2_9EURO Calcium uniporter protein OS=Cyphellophora europaea CBS 101466 OX=1220924 GN=HMPREF1541_00236 PE=1 SV=1
11	PDB:6dt0A	0.300	0.419	4.950E-9	236	0.131	0.195	6dt0A.pdb.gz
12	PDB:6dnfA	0.260	0.376	3.176E-8	225	0.128	0.200	6dnfA.pdb.gz
13	AFDB:Q1PE15	0.344	0.357	2.796E-7	338	0.171	0.178	Q1PE15.pdb.gz	MCU1_ARATH Calcium uniporter protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g36820 PE=2 SV=1
14	PDB:7np7D4	0.120	0.104	1.003E-2	415	0.088	0.075	7np7D4.pdb.gz
15	PDB:7np7D1	0.121	0.094	2.262E-2	485	0.091	0.066	7np7D1.pdb.gz
16	PDB:5ia8A	0.147	0.457	2.397E-2	92	0.040	0.152	5ia8A.pdb.gz
17	PDB:2b5uA	0.169	0.139	4.814E-2	470	0.117	0.087	2b5uA.pdb.gz
18	PDB:6mdhA	0.136	0.287	6.073E-2	149	0.034	0.081	6mdhA.pdb.gz
19	PDB:5ew5A	0.189	0.152	6.436E-2	490	0.103	0.073	5ew5A.pdb.gz
20	PDB:3ai5A	0.140	0.162	9.120E-2	299	0.028	0.033	3ai5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K059	0.0	572	331	0.801	0.849	A0A0G2K059_RAT Calcium uniporter protein OS=Rattus norvegicus OX=10116 GN=Mcu PE=1 SV=2
2	A0A8I6A2V9	0.0	607	310	0.829	0.939	A0A8I6A2V9_RAT Calcium uniporter protein OS=Rattus norvegicus OX=10116 GN=Mcu PE=1 SV=1
3	M0RDI5	0.0	605	323	0.829	0.901	M0RDI5_RAT Calcium uniporter protein OS=Rattus norvegicus OX=10116 GN=Mcu PE=3 SV=2
4	Q3UMR5	0.0	694	350	0.960	0.963	MCU_MOUSE Calcium uniporter protein, mitochondrial OS=Mus musculus OX=10090 GN=Mcu PE=1 SV=2
5	Q8NE86	0.0	726	351	1.000	1.000	MCU_HUMAN Calcium uniporter protein, mitochondrial OS=Homo sapiens OX=9606 GN=MCU PE=1 SV=1
6	Q08BI9	1.23e-172	486	376	0.709	0.662	MCU_DANRE Calcium uniporter protein, mitochondrial OS=Danio rerio OX=7955 GN=mcu PE=1 SV=1
7	Q8IQ70	5.90e-99	299	366	0.410	0.393	MCU_DROME Calcium uniporter protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MCU PE=1 SV=2
8	Q9NWR8	5.77e-98	295	336	0.396	0.414	MCUB_HUMAN Calcium uniporter regulatory subunit MCUb, mitochondrial OS=Homo sapiens OX=9606 GN=MCUB PE=1 SV=2
9	Q810S1	1.82e-87	269	345	0.373	0.380	MCUB_MOUSE Calcium uniporter regulatory subunit MCUb, mitochondrial OS=Mus musculus OX=10090 GN=Mcub PE=1 SV=1
10	Q21121	2.15e-80	250	333	0.336	0.354	MCU_CAEEL Calcium uniporter protein, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mcu-1 PE=1 SV=2
11	Q54LT0	3.54e-27	110	275	0.145	0.185	MCU_DICDI Calcium uniporter protein, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=DDB0186972 PE=1 SV=1
12	F4I111	1.08e-19	90.1	292	0.120	0.144	MCU6_ARATH Calcium uniporter protein 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g09575 PE=2 SV=1
13	Q1PE15	1.63e-14	75.9	338	0.123	0.127	MCU1_ARATH Calcium uniporter protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g36820 PE=2 SV=1
14	Q9LVR5	1.97e-12	69.3	321	0.128	0.140	MCU3_ARATH Calcium uniporter protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g66650 PE=2 SV=1
15	Q387B7	3.29e-07	53.5	307	0.071	0.081	Q387B7_TRYB2 Calcium uniporter protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.47.0014 PE=3 SV=1
16	Q7S4I4	3.77e-07	53.9	493	0.105	0.075	Q7S4I4_NEUCR Calcium uniporter protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU08166 PE=1 SV=1
17	Q38CK8	3.27e-06	50.1	254	0.068	0.094	Q38CK8_TRYB2 Calcium uniporter protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0180 PE=3 SV=1
18	E9DVV4	7.76e-06	49.7	484	0.097	0.070	E9DVV4_METAQ Calcium uniporter protein OS=Metarhizium acridum (strain CQMa 102) OX=655827 GN=MAC_01752 PE=1 SV=1
19	W2SDE2	0.001	42.4	346	0.094	0.095	W2SDE2_9EURO Calcium uniporter protein OS=Cyphellophora europaea CBS 101466 OX=1220924 GN=HMPREF1541_00236 PE=1 SV=1
20	Q385Z1	0.64	33.9	249	0.034	0.048	Q385Z1_TRYB2 Calcium uniporter protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1760 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04678 MCU	8.6e-68	239.4	Mitochondrial calcium uniporter
2	PF03105 SPX	1.4e+02	13.8	SPX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362144

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327467	0.999	Essential MCU regulator, mitochondrial
2	9606.ENSP00000354415	0.999	Calcium uptake protein 1, mitochondrial
3	9606.ENSP00000371811	0.999	Calcium uptake protein 2, mitochondrial
4	9606.ENSP00000368468	0.990	Mitochondrial calcium uniporter regulator 1
5	9606.ENSP00000321455	0.946	Calcium uptake protein 3, mitochondrial
6	9606.ENSP00000378145	0.942	Calcium uniporter regulatory subunit MCUb, mitochondrial
7	9606.ENSP00000351132	0.917	Mitochondrial Rho GTPase 1
8	9606.ENSP00000363435	0.898	Inositol 1,4,5-trisphosphate receptor type 3
9	9606.ENSP00000447091	0.897	Mitochondrial sodium/calcium exchanger protein
10	9606.ENSP00000306253	0.875	Inositol 1,4,5-trisphosphate receptor type 1
11	9606.ENSP00000305653	0.856	Mitochondrial proton/calcium exchanger protein
12	9606.ENSP00000301454	0.837	Calcium-binding mitochondrial carrier protein SCaMC-3
13	9606.ENSP00000268704	0.805	Paraplegin
14	9606.ENSP00000269143	0.795	AFG3-like protein 2
15	9606.ENSP00000295079	0.786	m-AAA protease-interacting protein 1, mitochondrial
16	9606.ENSP00000265333	0.779	Voltage-dependent anion-selective channel protein 1
17	9606.ENSP00000266544	0.772	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
18	9606.ENSP00000225174	0.728	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
19	9606.ENSP00000479488	0.718	Prohibitin
20	9606.ENSP00000441875	0.709	Prohibitin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015291	1.000	secondary active transmembrane transporter activity
GO:0015292	0.983	uniporter activity
GO:0042802	0.963	identical protein binding
GO:0015318	0.952	inorganic molecular entity transmembrane transporter activity
GO:0015075	0.933	monoatomic ion transmembrane transporter activity
GO:1901702	0.860	salt transmembrane transporter activity
GO:0022890	0.860	inorganic cation transmembrane transporter activity
GO:0008324	0.860	monoatomic cation transmembrane transporter activity
GO:0046873	0.804	metal ion transmembrane transporter activity
GO:0015085	0.724	calcium ion transmembrane transporter activity
GO:0015267	0.707	channel activity
GO:0005216	0.696	monoatomic ion channel activity
GO:0005261	0.671	monoatomic cation channel activity
GO:0005262	0.643	calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0051179	0.986	localization
GO:0006810	0.968	transport
GO:0055085	0.877	transmembrane transport
GO:0042592	0.866	homeostatic process
GO:0071702	0.834	organic substance transport
GO:0006811	0.832	monoatomic ion transport
GO:0098660	0.830	inorganic ion transmembrane transport
GO:0034220	0.823	monoatomic ion transmembrane transport
GO:0006874	0.818	intracellular calcium ion homeostasis
GO:0006812	0.812	monoatomic cation transport
GO:0070588	0.803	calcium ion transmembrane transport
GO:0051560	0.782	mitochondrial calcium ion homeostasis
GO:1990542	0.771	mitochondrial transmembrane transport
GO:0065007	0.641	biological regulation
GO:0050789	0.519	regulation of biological process
GO:0050794	0.380	regulation of cellular process
GO:0071840	0.356	cellular component organization or biogenesis
GO:0016043	0.353	cellular component organization
GO:0006851	0.333	mitochondrial calcium ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	1.000	mitochondrial inner membrane
GO:0032991	0.987	protein-containing complex
GO:0098796	0.913	membrane protein complex
GO:1902495	0.672	transmembrane transporter complex
GO:0098798	0.665	mitochondrial protein-containing complex
GO:0034704	0.656	calcium channel complex
GO:0098800	0.652	inner mitochondrial membrane protein complex
GO:1990246	0.496	uniplex complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.724	Ca(2+)(in) = Ca(2+)(out)

[back to server]