StarFunc result for job id Q8NEA6

User Input

>input (775 residues)
MMVQRLGLISPPASQVSTACNQISPSLQRAMNAANLNIPPSDTRSLISRESLASTTLSLT
ESQSASSMKQEWSQGYRALPSLSNHGSQNGLDLGDLLSLPPGTSMSSNSVSNSLPSYLFG
TESSHSPYPSPRHSSTRSHSARSKKRALSLSPLSDGIGIDFNTIIRTSPTSLVAYINGSR
ASPANLSPQPEVYGHFLGVRGSCIPQPRPVPGSQKGVLVAPGGLALPAYGEDGALEHERM
QQLEHGGLQPGLVNHMVVQHGLPGPDSQSAGLFKTERLEEFPGSTVDLPPAPPLPPLPPP
PGPPPPYHAHAHLHHPELGPHAQQLALPQATLDDDGEMDGIGGKHCCRWIDCSALYDQQE
ELVRHIEKVHIDQRKGEDFTCFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCE
KAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCT
KRYTDPSSLRKHVKAHSSKEQQARKKLRSSTELHPDLLTDCLTVQSLQPATSPRDAAAEG
TVGRSPGPGPDLYSAPIFSSNYSSRSGTAAGAVPPPHPVSHPSPGHNVQGSPHNPSSQLP
PLTAVDAGAERFAPSAPSPHHISPRRVPAPSSILQRTQPPYTQQPSGSHLKSYQPETNSS
FQPNGIHVHGFYGQLQKFCPPHYPDSQRIVPPVSSCSVVPSFEDCLVPTSMGQASFDVFH
RAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVDRCPSQLSSVYTEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NEA6	1.000	1.000	0.000	775	1.000	1.000	Q8NEA6.pdb.gz	GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens OX=9606 GN=GLIS3 PE=1 SV=5
2	AFDB:Q6XP49	0.334	0.332	1.154E-95	780	0.858	0.853	Q6XP49.pdb.gz	GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus OX=10090 GN=Glis3 PE=1 SV=2
3	AFDB:Q8K1M4	0.258	0.254	8.019E-35	789	0.351	0.345	Q8K1M4.pdb.gz	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2
4	AFDB:A0A2R8QMX9	0.203	0.113	4.087E-26	1443	0.297	0.159	A0A2R8QMX9.pdb.gz
5	AFDB:Q9IA31	0.211	0.112	7.074E-24	1544	0.293	0.147	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
6	AFDB:A0A5K4F1D0	0.205	0.066	2.335E-23	2566	0.244	0.074	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
7	AFDB:F1QH64	0.209	0.134	2.885E-22	1225	0.292	0.184	F1QH64.pdb.gz
8	AFDB:Q17308	0.204	0.137	6.681E-21	1165	0.225	0.149	Q17308.pdb.gz	TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae OX=6238 GN=tra-1 PE=1 SV=1
9	AFDB:Q4WT96	0.119	0.152	5.598E-15	570	0.150	0.204	Q4WT96.pdb.gz	Q4WT96_ASPFU C2H2 transcription factor, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G10080 PE=4 SV=1
10	AFDB:A0A0A0MT54	0.151	0.219	5.080E-11	522	0.155	0.230	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
11	PDB:5apny	0.044	0.131	9.608E-1	211	0.035	0.128	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
12	PDB:6lsr0	0.054	0.125	2.316	190	0.035	0.142	6lsr0.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
13	PDB:7jppB	0.041	0.087	3.829	307	0.017	0.042	7jppB.pdb.gz	The dynamic nature of the human Origin Recognition Complex revealed through five cryoEM structures.
14	PDB:1de5A	0.040	0.058	4.924	417	0.026	0.048	1de5A.pdb.gz	The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
15	PDB:2o03A	0.048	0.146	4.924	129	0.023	0.140	2o03A.pdb.gz	Crystal structure and function of the zinc uptake regulator FurB from Mycobacterium tuberculosis.
16	PDB:4yrvA	0.058	0.110	4.924	288	0.023	0.062	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
17	PDB:5l4kQ	0.043	0.072	5.584	422	0.014	0.026	5l4kQ.pdb.gz
18	PDB:3cuqA	0.037	0.081	6.331	219	0.021	0.073	3cuqA.pdb.gz
19	PDB:6ff4t	0.038	0.138	6.331	172	0.027	0.122	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:6hivCv	0.049	0.038	6.331	1059	0.035	0.025	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6XP49	0.0	1213	780	0.843	0.837	GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus OX=10090 GN=Glis3 PE=1 SV=2
2	Q8NEA6	0.0	1573	775	1.000	1.000	GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens OX=9606 GN=GLIS3 PE=1 SV=5
3	A1L1Q6	5.78e-159	483	787	0.472	0.465	A1L1Q6_DANRE GLIS family zinc finger 3 OS=Danio rerio OX=7955 GN=glis3 PE=2 SV=1
4	F1QB13	1.92e-158	482	803	0.472	0.456	F1QB13_DANRE GLIS family zinc finger 3 OS=Danio rerio OX=7955 GN=wu:fa55a05 PE=3 SV=1
5	Q8NBF1	3.34e-115	363	620	0.225	0.281	GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens OX=9606 GN=GLIS1 PE=1 SV=2
6	Q8K1M4	8.08e-112	360	789	0.234	0.229	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2
7	Q7K9G4	1.28e-79	274	806	0.156	0.150	Q7K9G4_DROME Zinc finger transcription factor OS=Drosophila melanogaster OX=7227 GN=lmd PE=2 SV=1
8	Q962I0	2.51e-79	274	866	0.156	0.140	Q962I0_DROME LD47926p OS=Drosophila melanogaster OX=7227 GN=lmd PE=2 SV=1
9	Q5BN24	2.15e-74	266	1363	0.235	0.134	Q5BN24_DANRE GLI family zinc finger 2b OS=Danio rerio OX=7955 GN=gli2b PE=2 SV=2
10	Q0VGV1	2.78e-73	263	1540	0.223	0.112	Q0VGV1_MOUSE Gli2 protein OS=Mus musculus OX=10090 GN=Gli2 PE=2 SV=1
11	F1M2B7	8.07e-68	246	1544	0.154	0.077	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3
12	A0A8I6AWR3	8.62e-68	246	1477	0.154	0.081	A0A8I6AWR3_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=1
13	Q0VGT2	2.92e-67	245	1544	0.152	0.076	GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus OX=10090 GN=Gli2 PE=1 SV=2
14	P10070	6.09e-67	244	1586	0.151	0.074	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
15	P55878	1.53e-65	229	556	0.137	0.191	GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus OX=9031 GN=GLI1 PE=2 SV=1
16	Q800Z9	3.90e-64	235	1404	0.142	0.078	Q800Z9_DANRE Zinc finger transcription factor detour OS=Danio rerio OX=7955 GN=gli1 PE=2 SV=1
17	F1QAC4	4.05e-64	235	1404	0.142	0.078	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
18	Q9IA31	5.15e-64	235	1544	0.138	0.069	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
19	Q61602	5.70e-64	235	1583	0.143	0.070	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
20	Q9YGS4	9.92e-64	234	1439	0.137	0.074	Q9YGS4_DANRE Zinc finger protein GLI2 OS=Danio rerio OX=7955 GN=you-too PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	0.00038	32.2	FOXP coiled-coil domain
2	PF00096 zf-C2H2	1.8e-11	55.0	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.0052	28.5	C2H2-type zinc finger
4	PF15909 zf-C2H2_8	70	15.2	C2H2-type zinc ribbon
5	PF17017 zf-C2H2_aberr	9.3e+02	11.4	Aberrant zinc-finger
6	PF13465 zf-H2C2_2	8.4e-07	40.3	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264414	0.911	Cullin-3
2	9606.ENSP00000358918	0.817	Suppressor of fused homolog
3	9606.ENSP00000310255	0.809	Probable G-protein coupled receptor 152
4	9606.ENSP00000419465	0.756	WW domain-containing transcription regulator protein 1
5	9606.ENSP00000480499	0.724	E3 ubiquitin-protein ligase Itchy homolog
6	9606.ENSP00000295108	0.693	Neurogenic differentiation factor 1
7	9606.ENSP00000379228	0.672	E3 ubiquitin-protein ligase HECW1
8	9606.ENSP00000245816	0.669	ATP-dependent Clp protease proteolytic subunit, mitochondrial
9	9606.ENSP00000311221	0.660	Zinc finger matrin-type protein 3
10	9606.ENSP00000297737	0.654	Zinc finger matrin-type 4
11	9606.ENSP00000262352	0.652	Excitatory amino acid transporter 3
12	9606.ENSP00000369755	0.651	C2 calcium-dependent domain-containing protein 4B
13	9606.ENSP00000332208	0.641	DNA-binding protein RFX6
14	9606.ENSP00000385780	0.639	Diacylglycerol kinase beta
15	9606.ENSP00000354687	0.630	NADH-ubiquinone oxidoreductase chain 1
16	9606.ENSP00000365687	0.627	Pancreas transcription factor 1 subunit alpha
17	9606.ENSP00000376390	0.625	Ras-related protein Rab-37
18	9606.ENSP00000345708	0.610	ATP-sensitive inward rectifier potassium channel 11
19	9606.ENSP00000257068	0.607	Melatonin receptor type 1B
20	9606.ENSP00000432799	0.604	Mesencephalic astrocyte-derived neurotrophic factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0097159	0.921	organic cyclic compound binding
GO:1901363	0.917	heterocyclic compound binding
GO:0003676	0.908	nucleic acid binding
GO:0003677	0.872	DNA binding
GO:0140110	0.764	transcription regulator activity
GO:0043565	0.758	sequence-specific DNA binding
GO:0003690	0.687	double-stranded DNA binding
GO:1990837	0.684	sequence-specific double-stranded DNA binding
GO:0003700	0.641	DNA-binding transcription factor activity
GO:0000977	0.593	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.562	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.523	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.365	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.979	regulation of cellular process
GO:0009987	0.950	cellular process
GO:0019222	0.882	regulation of metabolic process
GO:0051171	0.856	regulation of nitrogen compound metabolic process
GO:0080090	0.851	regulation of primary metabolic process
GO:0031323	0.850	regulation of cellular metabolic process
GO:0060255	0.840	regulation of macromolecule metabolic process
GO:0048519	0.829	negative regulation of biological process
GO:0010468	0.712	regulation of gene expression
GO:0048518	0.629	positive regulation of biological process
GO:0006355	0.626	regulation of DNA-templated transcription
GO:0048523	0.599	negative regulation of cellular process
GO:0048522	0.540	positive regulation of cellular process
GO:0032502	0.469	developmental process
GO:0032501	0.413	multicellular organismal process
GO:0008152	0.366	metabolic process
GO:0050896	0.355	response to stimulus
GO:0009892	0.319	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.956	intracellular non-membrane-bounded organelle
GO:0005737	0.560	cytoplasm
GO:0043233	0.525	organelle lumen
GO:0031981	0.457	nuclear lumen
GO:0005654	0.404	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]