StarFunc result for job id Q8NEJ9

User Input

>input (315 residues)
MAALGVLESDLPSAVTLLKNLQEQVMAVTAQVKSLTQKVQAGAYPTEKGLSFLEVKDQLL
LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTG
SLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVH
YDETEAEREKKRLERAKRRALSSSVIRELKEQYSDAPEEIRDARHPHVTRQSQEDQHRIN
YEESMMVRLSVSKREKGRRKRANVMSSQLHSLTHFSDISALTGGTVHLDEDQNPIKKRKK
IPQKGRKKKGFRRRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NEJ9	1.000	1.000	7.672E-48	315	1.000	1.000	Q8NEJ9.pdb.gz	NGDN_HUMAN Neuroguidin OS=Homo sapiens OX=9606 GN=NGDN PE=1 SV=1
2	AFDB:D3ZBL3	0.522	0.522	5.068E-41	315	0.898	0.898	D3ZBL3.pdb.gz	D3ZBL3_RAT Neuroguidin OS=Rattus norvegicus OX=10116 GN=Ngdn PE=1 SV=2
3	AFDB:Q8IGY8	0.415	0.395	7.953E-23	332	0.429	0.407	Q8IGY8.pdb.gz	Q8IGY8_DROME RE04093p OS=Drosophila melanogaster OX=7227 GN=CG11030 PE=2 SV=1
4	PDB:7mq8NC	0.269	0.808	1.991E-10	94	0.292	0.979	7mq8NC.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	AFDB:P40079	0.189	0.168	6.242E-8	357	0.187	0.165	P40079.pdb.gz	LCP5_YEAST U3 small nucleolar ribonucleoprotein protein LCP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LCP5 PE=1 SV=1
6	PDB:7suk6	0.268	0.300	5.126E-4	277	0.152	0.173	7suk6.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
7	AFDB:Q9JI13	0.238	0.168	3.484E-3	469	0.175	0.117	Q9JI13.pdb.gz	SAS10_MOUSE Something about silencing protein 10 OS=Mus musculus OX=10090 GN=Utp3 PE=1 SV=1
8	AFDB:Q8L3P4	0.245	0.131	2.769E-2	654	0.171	0.083	Q8L3P4.pdb.gz	THAL_ARATH Protein THALLO OS=Arabidopsis thaliana OX=3702 GN=THAL PE=1 SV=1
9	AFDB:Q6NPS1	0.124	0.045	7.564E-2	1171	0.162	0.044	Q6NPS1.pdb.gz	Q6NPS1_ARATH At1g61690 OS=Arabidopsis thaliana OX=3702 GN=At1g61690 PE=1 SV=1
10	AFDB:Q64127	0.104	0.042	1.418E-1	1051	0.105	0.031	Q64127.pdb.gz	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1
11	AFDB:E9AFF0	0.126	0.128	5.302E-1	309	0.102	0.104	E9AFF0.pdb.gz	E9AFF0_LEIMA Peroxin 19 OS=Leishmania major OX=5664 GN=LMJF_35_3260 PE=4 SV=1
12	AFDB:A0A0B4JDC9	0.158	0.044	5.645E-1	1844	0.073	0.012	A0A0B4JDC9.pdb.gz	A0A0B4JDC9_DROME RIM-binding protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
13	PDB:4v6wCh	0.096	0.200	9.623E-1	123	0.070	0.179	4v6wCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:4v6xCh	0.155	0.332	1.591	123	0.057	0.146	4v6xCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:6cnnA	0.172	0.153	2.800	360	0.035	0.031	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
16	PDB:6s1kE	0.119	0.256	3.380	102	0.048	0.147	6s1kE.pdb.gz
17	PDB:6sjbB	0.089	0.034	3.380	1129	0.051	0.014	6sjbB.pdb.gz	A conformational switch in response to Chi converts RecBCD from phage destruction to DNA repair.
18	PDB:3jcmG	0.054	0.027	4.081	734	0.083	0.035	3jcmG.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
19	PDB:6r1mB	0.175	0.132	4.081	428	0.029	0.021	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
20	PDB:6zr2d	0.107	0.194	4.346	120	0.038	0.100	6zr2d.pdb.gz	Structure of inhibitor-bound mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6ALQ0	0.0	518	311	0.844	0.855	A0A8I6ALQ0_RAT Neuroguidin OS=Rattus norvegicus OX=10116 GN=Ngdn PE=1 SV=1
2	Q8NEJ9	0.0	635	315	1.000	1.000	NGDN_HUMAN Neuroguidin OS=Homo sapiens OX=9606 GN=NGDN PE=1 SV=1
3	D3ZBL3	1.74e-174	487	312	0.790	0.798	D3ZBL3_RAT Neuroguidin OS=Rattus norvegicus OX=10116 GN=Ngdn PE=1 SV=2
4	A0A8I6ATG6	1.42e-160	451	304	0.746	0.773	A0A8I6ATG6_RAT Neuroguidin OS=Rattus norvegicus OX=10116 GN=Ngdn PE=1 SV=1
5	Q9VMM7	3.34e-64	207	332	0.378	0.358	Q9VMM7_DROME FI04466p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11030 PE=1 SV=2
6	Q8IGY8	7.01e-64	206	332	0.378	0.358	Q8IGY8_DROME RE04093p OS=Drosophila melanogaster OX=7227 GN=CG11030 PE=2 SV=1
7	Q9JI13	1.67e-09	60.8	469	0.114	0.077	SAS10_MOUSE Something about silencing protein 10 OS=Mus musculus OX=10090 GN=Utp3 PE=1 SV=1
8	Q384L4	2.08e-09	60.5	523	0.111	0.067	Q384L4_TRYB2 Sas10 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0490 PE=3 SV=1
9	Q8L3P4	3.92e-09	60.1	654	0.105	0.050	THAL_ARATH Protein THALLO OS=Arabidopsis thaliana OX=3702 GN=THAL PE=1 SV=1
10	Q09713	6.66e-07	52.4	327	0.089	0.086	YA36_SCHPO Uncharacterized protein C18B11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC18B11.06 PE=1 SV=1
11	Q9NQZ2	9.85e-06	49.3	479	0.105	0.069	SAS10_HUMAN Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1
12	P40079	0.008	40.0	357	0.089	0.078	LCP5_YEAST U3 small nucleolar ribonucleoprotein protein LCP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LCP5 PE=1 SV=1
13	P72161	0.46	34.3	310	0.156	0.158	PBP5_PSEAE D-alanyl-D-alanine endopeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pbpG PE=3 SV=2
14	Q57Z65	0.54	34.7	1188	0.108	0.029	Q57Z65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.380 PE=4 SV=1
15	Q9C9F5	0.84	33.5	308	0.063	0.065	C3H15_ARATH Zinc finger CCCH domain-containing protein 15 OS=Arabidopsis thaliana OX=3702 GN=C3H15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04000 Sas10_Utp3	3.3e-11	54.9	Sas10/Utp3/C1D family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371101	0.999	Nucleolar protein 10
2	9606.ENSP00000477848	0.999	Protein AATF
3	9606.ENSP00000225298	0.998	U3 small nucleolar RNA-associated protein 18 homolog
4	9606.ENSP00000261708	0.998	U3 small nucleolar RNA-associated protein 6 homolog
5	9606.ENSP00000229214	0.997	KRR1 small subunit processome component homolog
6	9606.ENSP00000232888	0.996	U3 small nucleolar RNA-interacting protein 2
7	9606.ENSP00000363746	0.996	WD repeat-containing protein 46
8	9606.ENSP00000423067	0.996	WD repeat-containing protein 36
9	9606.ENSP00000264279	0.995	Nucleolar protein 58
10	9606.ENSP00000297579	0.995	DDB1- and CUL4-associated factor 13
11	9606.ENSP00000327179	0.995	U3 small nucleolar RNA-associated protein 4 homolog
12	9606.ENSP00000328854	0.995	Nucleolar complex protein 4 homolog
13	9606.ENSP00000355541	0.995	HEAT repeat-containing protein 1
14	9606.ENSP00000362105	0.995	Probable U3 small nucleolar RNA-associated protein 11
15	9606.ENSP00000405068	0.994	Nucleolar protein 14
16	9606.ENSP00000384302	0.993	WD repeat-containing protein 43
17	9606.ENSP00000254803	0.992	Something about silencing protein 10
18	9606.ENSP00000257829	0.992	RNA cytidine acetyltransferase
19	9606.ENSP00000259239	0.992	U3 small nucleolar ribonucleoprotein protein IMP4
20	9606.ENSP00000230340	0.990	Bystin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.998	protein binding
GO:0045182	0.601	translation regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0019222	0.943	regulation of metabolic process
GO:0010468	0.895	regulation of gene expression
GO:0080090	0.894	regulation of primary metabolic process
GO:0051171	0.893	regulation of nitrogen compound metabolic process
GO:0010556	0.891	regulation of macromolecule biosynthetic process
GO:0031326	0.890	regulation of cellular biosynthetic process
GO:0051246	0.870	regulation of protein metabolic process
GO:0010608	0.861	post-transcriptional regulation of gene expression
GO:0006417	0.837	regulation of translation
GO:0010646	0.832	regulation of cell communication
GO:0023051	0.828	regulation of signaling
GO:0099177	0.663	regulation of trans-synaptic signaling
GO:0050804	0.581	modulation of chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0005737	0.952	cytoplasm
GO:0005730	0.901	nucleolus
GO:0005739	0.617	mitochondrion
GO:0030054	0.467	cell junction
GO:0005829	0.335	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]