StarFunc result for job id Q8NEL9

User Input

>input (900 residues)
MNYPGRGSPRSPEHNGRGGGGGAWELGSDARPAFGGGVCCFEHLPGGDPDDGDVPLALLR
GEPGLHLAPGTDDHNHHLALDPCLSDENYDFSSAESGSSLRYYSEGESGGGGSSLSLHPP
QQPPLVPTNSGGGGATGGSPGERKRTRLGGPAARHRYEVVTELGPEEVRWFYKEDKKTWK
PFIGYDSLRIELAFRTLLQTTGARPQGGDRDGDHVCSPTGPASSSGEDDDEDRACGFCQS
TTGHEPEMVELVNIEPVCVRGGLYEVDVTQGECYPVYWNQADKIPVMRGQWFIDGTWQPL
EEEESNLIEQEHLNCFRGQQMQENFDIEVSKSIDGKDAVHSFKLSRNHVDWHSVDEVYLY
SDATTSKIARTVTQKLGFSKASSSGTRLHRGYVEEATLEDKPSQTTHIVFVVHGIGQKMD
QGRIIKNTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLR
DMLNSSAMDIMYYTSPLYRDELVKGLQQELNRLYSLFCSRNPDFEEKGGKVSIVSHSLGC
VITYDIMTGWNPVRLYEQLLQKEEELPDERWMSYEERHLLDELYITKRRLKEIEERLHGL
KASSMTQTPALKFKVENFFCMGSPLAVFLALRGIRPGNTGSQDHILPREICNRLLNIFHP
TDPVAYRLEPLILKHYSNISPVQIHWYNTSNPLPYEHMKPSFLNPAKEPTSVSENEGIST
IPSPVTSPVLSRRHYGESITNIGKASILGAASIGKGLGGMLFSRFGRSSTTQSSETSKDS
MEDEKKPVASPSATTVGTQTLPHSSSGFLDSAYFRLQESFFNLPQLLFPENVMQNKDNAL
VELDHRIDFELREGLVESRYWSAVTSHTAYWSSLDVALFLLTFMYKHEHDDDAKPNLDPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NEL9	1.000	1.000	0.000	900	1.000	1.000	Q8NEL9.pdb.gz	DDHD1_HUMAN Phospholipase DDHD1 OS=Homo sapiens OX=9606 GN=DDHD1 PE=1 SV=2
2	AFDB:Q9Y6Y8	0.391	0.355	6.000E-26	1000	0.211	0.190	Q9Y6Y8.pdb.gz	S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1
3	AFDB:Q9VUQ9	0.068	0.040	9.080E-4	2139	0.140	0.059	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
4	AFDB:Q8IQ73	0.047	0.040	2.374E-2	1107	0.148	0.120	Q8IQ73.pdb.gz	Q8IQ73_DROME Cornetto, isoform C OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=2
5	AFDB:Q8CHH5	0.041	0.037	4.456E-2	1074	0.121	0.101	Q8CHH5.pdb.gz	BICRL_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Mus musculus OX=10090 GN=Bicral PE=1 SV=2
6	PDB:3gbsA	0.081	0.296	5.105E-2	187	0.019	0.091	3gbsA.pdb.gz
7	AFDB:A0A1D8PFD3	0.057	0.052	5.603E-2	1001	0.126	0.113	A0A1D8PFD3.pdb.gz	A0A1D8PFD3_CANAL Snt1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNT1 PE=4 SV=1
8	AFDB:U3JAG9	0.037	0.032	5.603E-2	1113	0.109	0.088	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
9	AFDB:F4J6F6	0.052	0.040	5.933E-2	1296	0.133	0.093	F4J6F6.pdb.gz	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
10	AFDB:Q9SZQ2	0.063	0.051	5.933E-2	1211	0.124	0.092	Q9SZQ2.pdb.gz	Q9SZQ2_ARATH AT4g29790/F27B13_30 OS=Arabidopsis thaliana OX=3702 GN=At4g29790 PE=1 SV=1
11	AFDB:A0A1D8PGE6	0.044	0.047	6.283E-2	838	0.110	0.118	A0A1D8PGE6.pdb.gz	A0A1D8PGE6_CANAL Hap42p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAP42 PE=4 SV=1
12	PDB:1ycdB	0.096	0.289	6.797E-2	238	0.027	0.101	1ycdB.pdb.gz	Crystal structure of yeast YHR049W/FSH1, a member of the serine hydrolase family.
13	PDB:4lafA	0.075	0.224	7.621E-2	207	0.033	0.145	4lafA.pdb.gz	Crystal structure of PnpB complex with FMN
14	PDB:1vkhA	0.098	0.289	9.583E-2	261	0.033	0.115	1vkhA.pdb.gz
15	PDB:3dcnA	0.084	0.311	1.138E-1	195	0.019	0.087	3dcnA.pdb.gz
16	PDB:3esbA	0.078	0.293	1.431E-1	199	0.019	0.085	3esbA.pdb.gz	Solid-state structural characterization of cutinase-ECE-pincer-metal hybrids
17	PDB:4r3zB	0.100	0.121	2.536E-1	659	0.033	0.046	4r3zB.pdb.gz
18	PDB:5synA	0.075	0.239	2.686E-1	223	0.028	0.112	5synA.pdb.gz	Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
19	PDB:1i6wB	0.111	0.421	3.012E-1	180	0.042	0.211	1i6wB.pdb.gz
20	PDB:5oqj4	0.067	0.160	3.576E-1	297	0.012	0.037	5oqj4.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80YA3	0.0	1053	547	0.563	0.927	DDHD1_MOUSE Phospholipase DDHD1 OS=Mus musculus OX=10090 GN=Ddhd1 PE=1 SV=1
2	Q8NEL9	0.0	1868	900	1.000	1.000	DDHD1_HUMAN Phospholipase DDHD1 OS=Homo sapiens OX=9606 GN=DDHD1 PE=1 SV=2
3	G5EEM9	1.26e-86	296	840	0.220	0.236	PLA1_CAEEL Intracellular phospholipase A1 OS=Caenorhabditis elegans OX=6239 GN=ipla-1 PE=1 SV=1
4	Q8W5R2	3.13e-40	162	933	0.119	0.115	SHGR2_ARATH Phospholipase SGR2 OS=Arabidopsis thaliana OX=3702 GN=SGR2 PE=1 SV=1
5	X2JDJ3	9.58e-37	152	2015	0.133	0.060	X2JDJ3_DROME Phosphatidic acid phospholipase A1, isoform D OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
6	M9MRD9	5.38e-35	144	663	0.172	0.234	M9MRD9_DROME Phosphatidic acid phospholipase A1, isoform B OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
7	Q9VLS7	1.76e-34	145	2016	0.133	0.060	Q9VLS7_DROME LD21067p OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
8	Q80Y98	2.74e-34	142	699	0.150	0.193	DDHD2_MOUSE Phospholipase DDHD2 OS=Mus musculus OX=10090 GN=Ddhd2 PE=1 SV=3
9	Q8MQQ8	3.50e-34	144	1332	0.134	0.091	Q8MQQ8_DROME LD21041p (Fragment) OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=2 SV=1
10	O94830	9.18e-26	116	711	0.107	0.135	DDHD2_HUMAN Phospholipase DDHD2 OS=Homo sapiens OX=9606 GN=DDHD2 PE=1 SV=2
11	P87109	5.72e-25	114	757	0.140	0.166	YDK2_SCHPO Probable phospholipase C20G8.02, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC20G8.02 PE=3 SV=1
12	Q9Y6Y8	1.46e-24	113	1000	0.142	0.128	S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1
13	Q6NZC7	1.48e-22	106	998	0.101	0.091	S23IP_MOUSE SEC23-interacting protein OS=Mus musculus OX=10090 GN=Sec23ip PE=1 SV=2
14	Q12204	2.94e-21	102	715	0.086	0.108	YOR22_YEAST Probable phospholipase YOR022C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR022C PE=1 SV=1
15	Q7LKZ6	7.43e-17	87.8	669	0.129	0.173	YJMD_SCHPO Probable phospholipase C1020.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1020.13c PE=3 SV=1
16	P43125	1.80e-12	73.9	1259	0.088	0.063	RDGB_DROME Protein retinal degeneration B OS=Drosophila melanogaster OX=7227 GN=rdgB PE=1 SV=2
17	O00562	2.00e-09	63.9	1244	0.037	0.027	PITM1_HUMAN Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1 PE=1 SV=4
18	Q5U2N3	6.30e-09	62.4	1242	0.037	0.027	PITM1_RAT Membrane-associated phosphatidylinositol transfer protein 1 OS=Rattus norvegicus OX=10116 GN=Pitpnm1 PE=1 SV=1
19	Q6ZPQ6	6.60e-07	55.8	1335	0.031	0.021	PITM2_MOUSE Membrane-associated phosphatidylinositol transfer protein 2 OS=Mus musculus OX=10090 GN=Pitpnm2 PE=1 SV=2
20	F1LXD6	7.75e-07	55.8	1331	0.031	0.021	F1LXD6_RAT Phosphatidylinositol transfer protein, membrane-associated 2 OS=Rattus norvegicus OX=10116 GN=Pitpnm2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02862 DDHD	1.2e-53	194.3	DDHD domain
2	PF05057 DUF676	2.7e+02	12.5	Putative serine esterase (DUF676)
3	PF02825 WWE	0.49	22.4	WWE domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327104

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380352	0.867	Phospholipase DDHD2
2	9606.ENSP00000281741	0.730	Thioredoxin domain containing 16
3	9606.ENSP00000260264	0.725	POU domain, class 2, transcription factor 3
4	9606.ENSP00000315106	0.712	Integral membrane protein GPR137C
5	9606.ENSP00000407509	0.681	Neuropathy target esterase
6	9606.ENSP00000377250	0.663	Protein MON2 homolog
7	9606.ENSP00000333212	0.634	Cytochrome P450 2U1
8	9606.ENSP00000294618	0.628	Dedicator of cytokinesis protein 6
9	9606.ENSP00000328327	0.614	Ankyrin repeat and SOCS box protein 7
10	9606.ENSP00000261700	0.613	RNA transcription, translation and transport factor protein
11	9606.ENSP00000342858	0.603	Fermitin family homolog 2
12	9606.ENSP00000367343	0.593	Non-lysosomal glucosylceramidase
13	9606.ENSP00000297562	0.592	AP-5 complex subunit zeta-1
14	9606.ENSP00000262764	0.590	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial
15	9606.ENSP00000443292	0.590	Protein FAM222A
16	9606.ENSP00000334448	0.589	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
17	9606.ENSP00000219368	0.582	Fatty acid 2-hydroxylase
18	9606.ENSP00000245457	0.579	Prostaglandin E2 receptor EP2 subtype
19	9606.ENSP00000216286	0.577	Nidogen-2
20	9606.ENSP00000401802	0.569	26S proteasome regulatory subunit 10B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.849	catalytic activity
GO:0016787	0.801	hydrolase activity
GO:0016788	0.575	hydrolase activity, acting on ester bonds
GO:0016298	0.438	lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.977	regulation of biological process
GO:0050794	0.972	regulation of cellular process
GO:0009987	0.868	cellular process
GO:0033043	0.835	regulation of organelle organization
GO:0048518	0.823	positive regulation of biological process
GO:0050793	0.786	regulation of developmental process
GO:0010821	0.736	regulation of mitochondrion organization
GO:0010822	0.707	positive regulation of mitochondrion organization
GO:0022603	0.676	regulation of anatomical structure morphogenesis
GO:0090140	0.648	regulation of mitochondrial fission
GO:0051094	0.462	positive regulation of developmental process
GO:0008152	0.437	metabolic process
GO:0071704	0.342	organic substance metabolic process
GO:0044238	0.342	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.834	intracellular membrane-bounded organelle
GO:0016020	0.388	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.801	Hydrolases.
EC:3.1.-.-	0.575	Acting on ester bonds.

[back to server]