StarFunc result for job id Q8NEM2

User Input

>input (672 residues)
MADGSLTGGGLEAAAMAPERMGWAVEQELASLEKGLFQDEDSCSDCSYRDKPGSSLQSFM
PEGKTFFPEIFQTNQLLFYERFRAYQDYILADCKASEVQEFTAEFLEKVLEPSGWRAVWH
TNVFKVLVEITDVDFAALKAVVRLAEPYLCDSQVSTFTMECMKELLDLKEHRLPLQELWV
VFDDSGVFDQTALAIEHVRFFYQNIWRSWDEEEEDEYDYFVRCVEPRLRLHYDILEDRVP
SGLIVDYHNLLSQCEESYRKFLNLRSSLSNCNSDSEQENISMVEGLKLYSEMEQLKQKLK
LIENPLLRYVFGYQKNSNIQAKGVRSSGQKITHVVSSTMMAGLLRSLLTDRLCQEPGEEE
REIQFHSDPLSAINACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKG
DTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMK
NSDLYGAKGAGIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNE
GYGVVLVKPTIFSDLQENAEDGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCA
RTDPSEQVEGNCEIVNELIAASTQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFK
WNGKGSFGTFLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NEM2	1.000	1.000	0.000	672	1.000	1.000	Q8NEM2.pdb.gz	SHCBP_HUMAN SHC SH2 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SHCBP1 PE=1 SV=3
2	AFDB:Q9Z179	0.778	0.783	6.684E-86	668	0.775	0.780	Q9Z179.pdb.gz	SHCBP_MOUSE SHC SH2 domain-binding protein 1 OS=Mus musculus OX=10090 GN=Shcbp1 PE=1 SV=1
3	AFDB:Q9BZQ2	0.548	0.561	1.160E-34	653	0.262	0.270	Q9BZQ2.pdb.gz	SHP1L_HUMAN Testicular spindle-associated protein SHCBP1L OS=Homo sapiens OX=9606 GN=SHCBP1L PE=1 SV=3
4	AFDB:Q3TTP0	0.551	0.575	3.310E-34	639	0.266	0.280	Q3TTP0.pdb.gz	SHP1L_MOUSE Testicular spindle-associated protein SHCBP1L OS=Mus musculus OX=10090 GN=Shcbp1l PE=1 SV=1
5	AFDB:Q9VIP0	0.295	0.326	9.674E-21	602	0.164	0.183	Q9VIP0.pdb.gz	NESD_DROME Protein nessun dorma OS=Drosophila melanogaster OX=7227 GN=nesd PE=1 SV=1
6	AFDB:Q7TPD1	0.226	0.168	6.212E-5	930	0.070	0.051	Q7TPD1.pdb.gz	FBX11_MOUSE F-box only protein 11 OS=Mus musculus OX=10090 GN=Fbxo11 PE=1 SV=3
7	PDB:1ru4A	0.172	0.267	6.664E-4	400	0.046	0.077	1ru4A.pdb.gz	The crystal structure of pectate lyase Pel9A from Erwinia chrysanthemi
8	AFDB:Q94251	0.223	0.166	4.118E-3	936	0.054	0.038	Q94251.pdb.gz	DRE1_CAEEL F-box protein dre-1 OS=Caenorhabditis elegans OX=6239 GN=dre-1 PE=1 SV=3
9	PDB:2nspA	0.196	0.358	2.308E-2	342	0.037	0.073	2nspA.pdb.gz	Molecular basis of the activity of the phytopathogen pectin methylesterase.
10	PDB:4pmhA	0.187	0.322	2.308E-2	366	0.036	0.066	4pmhA.pdb.gz
11	PDB:3grhA	0.172	0.274	2.963E-2	397	0.051	0.086	3grhA.pdb.gz
12	AFDB:Q583P6	0.089	0.064	1.657E-1	1085	0.068	0.042	Q583P6.pdb.gz	Q583P6_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.490 PE=3 SV=1
13	PDB:4c92B	0.063	0.251	3.974E-1	105	0.016	0.105	4c92B.pdb.gz
14	PDB:5nrll	0.052	0.241	4.392E-1	99	0.022	0.152	5nrll.pdb.gz	Structure of a pre-catalytic spliceosome.
15	PDB:2qimA	0.059	0.176	5.101E-1	157	0.024	0.102	2qimA.pdb.gz	Lupinus luteus pathogenesis-related protein as a reservoir for cytokinin.
16	AFDB:Q8R5M3	0.087	0.095	6.069E-1	578	0.043	0.050	Q8R5M3.pdb.gz	LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus OX=10116 GN=Lrrc15 PE=2 SV=1
17	PDB:3sxuB	0.075	0.311	6.883E-1	102	0.015	0.098	3sxuB.pdb.gz	Structure of the SSB-DNA polymerase III interface and its role in DNA replication.
18	PDB:6ppnB	0.080	0.303	7.995E-1	94	0.024	0.170	6ppnB.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
19	PDB:7fd4B	0.050	0.045	9.287E-1	779	0.073	0.063	7fd4B.pdb.gz	Complete three-dimensional structures of the Lon protease translocating a protein substrate.
20	AFDB:Q5H9M0	0.086	0.084	1.349	696	0.068	0.066	Q5H9M0.pdb.gz	PWP3B_HUMAN PWWP domain-containing DNA repair factor 3B OS=Homo sapiens OX=9606 GN=PWWP3B PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NEM2	0.0	1393	672	1.000	1.000	SHCBP_HUMAN SHC SH2 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SHCBP1 PE=1 SV=3
2	Q9Z179	0.0	1062	668	0.778	0.783	SHCBP_MOUSE SHC SH2 domain-binding protein 1 OS=Mus musculus OX=10090 GN=Shcbp1 PE=1 SV=1
3	Q9BZQ2	3.64e-69	239	653	0.237	0.243	SHP1L_HUMAN Testicular spindle-associated protein SHCBP1L OS=Homo sapiens OX=9606 GN=SHCBP1L PE=1 SV=3
4	Q3TTP0	2.80e-66	231	639	0.234	0.246	SHP1L_MOUSE Testicular spindle-associated protein SHCBP1L OS=Mus musculus OX=10090 GN=Shcbp1l PE=1 SV=1
5	Q9VIP0	2.92e-14	78.6	602	0.158	0.176	NESD_DROME Protein nessun dorma OS=Drosophila melanogaster OX=7227 GN=nesd PE=1 SV=1
6	Q9UK96	0.052	39.3	956	0.042	0.029	FBX10_HUMAN F-box only protein 10 OS=Homo sapiens OX=9606 GN=FBXO10 PE=1 SV=3
7	Q94FT2	0.14	37.4	274	0.043	0.106	SKIP5_ARATH F-box protein SKIP5 OS=Arabidopsis thaliana OX=3702 GN=SKIP5 PE=1 SV=1
8	P30418	1.3	34.7	451	0.021	0.031	NMT_CANAL Glycylpeptide N-tetradecanoyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NMT1 PE=1 SV=2
9	Q57ZK8	2.4	33.5	267	0.060	0.150	Q57ZK8_TRYB2 Right handed beta helix domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.540 PE=4 SV=1
10	O75323	5.1	32.3	286	0.030	0.070	NIPS2_HUMAN Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2 PE=1 SV=1
11	Q9VGP0	7.7	31.2	158	0.030	0.127	DTD_DROME D-aminoacyl-tRNA deacylase OS=Drosophila melanogaster OX=7227 GN=Dtd PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13229 Beta_helix	3.8e-09	48.1	Right handed beta helix region
2	PF10303 DUF2408	34	16.5	Protein of unknown function (DUF2408)
3	PF05971 Methyltransf_10	2.9e+02	12.2	RNA methyltransferase
4	PF05048 NosD	9.8e-06	36.7	Periplasmic copper-binding protein (NosD)
5	PF12708 Pectate_lyase_3	0.25	22.7	Pectate lyase superfamily protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306473

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000404190	0.984	Rac GTPase-activating protein 1
2	9606.ENSP00000260363	0.956	Kinesin-like protein KIF23
3	9606.ENSP00000251496	0.948	Condensin complex subunit 3
4	9606.ENSP00000274026	0.943	Cyclin-A2
5	9606.ENSP00000378356	0.939	Kinesin-like protein KIF20A
6	9606.ENSP00000362146	0.933	Borealin
7	9606.ENSP00000411532	0.901	DNA topoisomerase 2-alpha
8	9606.ENSP00000376457	0.899	Protein ECT2
9	9606.ENSP00000378699	0.889	Cyclin-dependent kinase 1
10	9606.ENSP00000377793	0.888	Protein regulator of cytokinesis 1
11	9606.ENSP00000287598	0.882	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
12	9606.ENSP00000288207	0.880	G2/mitotic-specific cyclin-B2
13	9606.ENSP00000363524	0.873	Chromosome-associated kinesin KIF4A
14	9606.ENSP00000361540	0.868	Cell division cycle protein 20 homolog
15	9606.ENSP00000300403	0.867	Targeting protein for Xklp2
16	9606.ENSP00000302530	0.865	Mitotic checkpoint serine/threonine-protein kinase BUB1
17	9606.ENSP00000401303	0.862	SHC-transforming protein 1
18	9606.ENSP00000453403	0.851	Nucleolar and spindle-associated protein 1
19	9606.ENSP00000428489	0.850	Lymphokine-activated killer T-cell-originated protein kinase
20	9606.ENSP00000298048	0.849	Maternal embryonic leucine zipper kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.358	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.842	response to stimulus
GO:0051716	0.743	cellular response to stimulus
GO:0007165	0.428	signal transduction
GO:0071704	0.424	organic substance metabolic process
GO:0044238	0.399	primary metabolic process
GO:0042127	0.395	regulation of cell population proliferation
GO:0006807	0.378	nitrogen compound metabolic process
GO:0048518	0.375	positive regulation of biological process
GO:0071363	0.369	cellular response to growth factor stimulus
GO:0008543	0.360	fibroblast growth factor receptor signaling pathway
GO:0048522	0.337	positive regulation of cellular process
GO:2000177	0.324	regulation of neural precursor cell proliferation
GO:0044237	0.323	cellular metabolic process
GO:0043170	0.313	macromolecule metabolic process
GO:0071840	0.300	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0015630	0.997	microtubule cytoskeleton
GO:0005819	0.994	spindle
GO:0005634	0.986	nucleus
GO:0005829	0.977	cytosol
GO:0031981	0.966	nuclear lumen
GO:0005654	0.955	nucleoplasm
GO:0072687	0.546	meiotic spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]