StarFunc result for job id Q8NEM8

User Input

>input (1001 residues)
MSEDSEKEDYSDRTISDEDESDEDMFMKFVSEDLHRCALLTADSFGDPFFPRTTQILLEY
QLGRWVPRLREPRDLYGVSSSGPLSPTRWPYHCEVIDEKVQHIDWTPSCPEPVYIPTGLE
TEPLYPDSKEATVVYLAEDAYKEPCFVYSRVGGNRTPLKQPVDYRDNTLMFEARFESGNL
QKVVKVAEYEYQLTVRPDLFTNKHTQWYYFQVTNMRAGIVYRFTIVNFTKPASLYSRGMR
PLFYSEKEAKAHHIGWQRIGDQIKYYRNNPGQDGRHYFSLTWTFQFPHNKDTCYFAHCYP
YTYTNLQEYLSGINNDPVRSKFCKIRVLCHTLARNMVYILTITTPLKNSDSRKRKAVILT
ARVHPGETNSSWIMKGFLDYILGNSSDAQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGR
DLNRNYTSLLKESFPSVWYTRNMVHRLMEKREVILYCDLHGHSRKENIFMYGCDGSDRSK
TLYLQQRIFPLMLSKNCPDKFSFSACKFNVQKSKEGTGRVVMWKMGIRNSFTMEATFCGS
TLGNKRGTHFSTKDLESMGYHFCDSLLDYCDPDRTKYYRCLKELEEMERHITLEKVFEDS
DTPVIDITLDVESSSRGSDSSESIDSLTYLLKLTSQKKHLKTKKERNSTIASHQNARGQE
VYDRGHLLQRHTQSNSDVKDTRPNEPDDYMVDYFRRQLPNQGLAHCKLRLPGSRHSPASA
SRVAGTTGTRHHTWLIFVFLVEMGKKIPLKGTDLYGNCFKVTSLQSPMGKQTSTWTEKTR
IPTEDLHHNLKSKIKECISFQSKKTGINWTDDEKRSYKDKGIVQTQEILQYLLPIVHSTK
NMQTTQIKQLFNPRTNFQIQHQLNPATCRNIKKYSTSWTAPRNHPFVIQGDVMANSSEWV
QSKPHRSLESLSPLKGPKKNKHSQIWAIKNEDIKPLSSKWETASSSFGMDANVLKYKSLQ
AEETNQQSSKHTALHLTKNKDEQANKNDGQPTLYLKFQRES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CDP0	0.577	0.574	0.000	1006	0.726	0.723	Q8CDP0.pdb.gz	CBPC3_MOUSE Cytosolic carboxypeptidase 3 OS=Mus musculus OX=10090 GN=Agbl3 PE=1 SV=1
2	AFDB:Q8NEM8	1.000	1.000	0.000	1001	1.000	1.000	Q8NEM8.pdb.gz	CBPC3_HUMAN Cytosolic carboxypeptidase 3 OS=Homo sapiens OX=9606 GN=AGBL3 PE=2 SV=2
3	AFDB:Q9VY99	0.437	0.366	1.287E-59	1201	0.251	0.209	Q9VY99.pdb.gz	NNAD_DROME Cytosolic carboxypeptidase Nna1 OS=Drosophila melanogaster OX=7227 GN=Nna1 PE=2 SV=2
4	PDB:1kwmA	0.211	0.470	1.222E-12	402	0.054	0.134	1kwmA.pdb.gz	Human procarboxypeptidase B: three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI).
5	PDB:5mrvA	0.214	0.620	1.708E-12	307	0.047	0.153	5mrvA.pdb.gz	Crystal structure and mechanism of human carboxypeptidase O: Insights into its specific activity for acidic residues.
6	PDB:4p10A	0.226	0.508	2.257E-12	402	0.046	0.114	4p10A.pdb.gz	Design and synthesis of conformationally restricted inhibitors of active thrombin activatable fibrinolysis inhibitor (TAFIa).
7	PDB:1h8lA	0.201	0.473	3.284E-11	380	0.042	0.111	1h8lA.pdb.gz	The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
8	PDB:1uwyA	0.209	0.482	1.957E-10	393	0.041	0.104	1uwyA.pdb.gz	Crystal Structure of Human Carboxypeptidase M, a Membrane-Bound Enzyme that Regulates Peptide Hormone Activity
9	PDB:1ayeA	0.212	0.479	3.419E-10	401	0.052	0.130	1ayeA.pdb.gz	The three-dimensional structure of human procarboxypeptidase A2. Deciphering the basis of the inhibition, activation and intrinsic activity of the zymogen.
10	PDB:2nsmA	0.200	0.454	7.895E-10	390	0.050	0.128	2nsmA.pdb.gz
11	PDB:5hvfA	0.199	0.484	5.261E-9	372	0.046	0.124	5hvfA.pdb.gz	Elucidation of the molecular mechanisms of two nanobodies that inhibit thrombin-activatable fibrinolysis inhibitor activation and activated thrombin-activatable fibrinolysis inhibitor activity.
12	PDB:2gu2A	0.154	0.438	2.336E-7	307	0.035	0.114	2gu2A.pdb.gz	Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
13	PDB:4axvA	0.161	0.539	2.762E-7	241	0.044	0.183	4axvA.pdb.gz	Mpaa is a Murein-Tripeptide-Specific Zinc Carboxypeptidase that Functions as Part of a Catabolic Pathway for Peptidoglycan Derived Peptides in Gamma-Proteobacteria.
14	AFDB:E9PYK3	0.072	0.048	2.782E-4	1969	0.077	0.039	E9PYK3.pdb.gz	PARP4_MOUSE Protein mono-ADP-ribosyltransferase PARP4 OS=Mus musculus OX=10090 GN=Parp4 PE=1 SV=1
15	AFDB:Q12188	0.046	0.053	2.282E-2	680	0.064	0.094	Q12188.pdb.gz	REC8_YEAST Meiotic recombination protein REC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REC8 PE=1 SV=1
16	AFDB:O95490	0.063	0.049	9.205E-2	1459	0.097	0.066	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
17	AFDB:Q9UKV3	0.036	0.029	1.521E-1	1341	0.069	0.051	Q9UKV3.pdb.gz	ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2
18	AFDB:Q9TW45	0.063	0.056	2.247E-1	1192	0.125	0.105	Q9TW45.pdb.gz	PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans OX=6239 GN=par-1 PE=1 SV=1
19	AFDB:A0A024RAY7	0.047	0.042	2.512E-1	1174	0.063	0.054	A0A024RAY7.pdb.gz
20	AFDB:P39447	0.058	0.041	3.511E-1	1745	0.130	0.074	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5U5Z8	0.0	692	902	0.346	0.384	CBPC2_HUMAN Cytosolic carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=AGBL2 PE=1 SV=2
2	Q8CDK2	0.0	702	862	0.346	0.401	CBPC2_MOUSE Cytosolic carboxypeptidase 2 OS=Mus musculus OX=10090 GN=Agbl2 PE=1 SV=1
3	Q8CDP0	0.0	1428	1006	0.731	0.728	CBPC3_MOUSE Cytosolic carboxypeptidase 3 OS=Mus musculus OX=10090 GN=Agbl3 PE=1 SV=1
4	Q8NEM8	0.0	2107	1001	1.000	1.000	CBPC3_HUMAN Cytosolic carboxypeptidase 3 OS=Homo sapiens OX=9606 GN=AGBL3 PE=2 SV=2
5	Q9VY99	8.14e-157	496	1201	0.233	0.194	NNAD_DROME Cytosolic carboxypeptidase Nna1 OS=Drosophila melanogaster OX=7227 GN=Nna1 PE=2 SV=2
6	Q641K1	5.00e-110	371	1218	0.191	0.157	CBPC1_MOUSE Cytosolic carboxypeptidase 1 OS=Mus musculus OX=10090 GN=Agtpbp1 PE=1 SV=2
7	Q9UPW5	5.55e-108	365	1226	0.188	0.153	CBPC1_HUMAN Cytosolic carboxypeptidase 1 OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=3
8	J3KNS1	1.35e-107	365	1278	0.188	0.147	J3KNS1_HUMAN tubulin-glutamate carboxypeptidase OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=1
9	Q09M05	1.92e-105	356	1122	0.181	0.161	CBPC4_MOUSE Cytosolic carboxypeptidase 4 OS=Mus musculus OX=10090 GN=Agbl1 PE=1 SV=3
10	Q4U2V3	2.25e-105	357	1153	0.183	0.159	CBPC1_DANRE Cytosolic carboxypeptidase 1 OS=Danio rerio OX=7955 GN=agtpbp1 PE=2 SV=1
11	O76373	2.09e-92	318	1015	0.164	0.162	CBPC1_CAEEL Cytosolic carboxypeptidase 1 OS=Caenorhabditis elegans OX=6239 GN=ccpp-1 PE=1 SV=2
12	Q5VU57	5.22e-69	241	503	0.150	0.298	CBPC6_HUMAN Cytosolic carboxypeptidase 6 OS=Homo sapiens OX=9606 GN=AGBL4 PE=2 SV=3
13	Q09LZ8	5.71e-68	239	540	0.142	0.263	CBPC6_MOUSE Cytosolic carboxypeptidase 6 OS=Mus musculus OX=10090 GN=Agbl4 PE=1 SV=1
14	Q389Q3	4.09e-66	246	1570	0.163	0.104	Q389Q3_TRYB2 Zinc carboxypeptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0130 PE=3 SV=1
15	Q09296	1.73e-64	227	459	0.142	0.309	CBPC6_CAEEL Cytosolic carboxypeptidase 6 OS=Caenorhabditis elegans OX=6239 GN=ccpp-6 PE=1 SV=2
16	Q09M02	1.26e-35	148	886	0.108	0.122	CBPC5_MOUSE Cytosolic carboxypeptidase-like protein 5 OS=Mus musculus OX=10090 GN=Agbl5 PE=1 SV=2
17	Q8NDL9	1.32e-35	148	886	0.108	0.122	CBPC5_HUMAN Cytosolic carboxypeptidase-like protein 5 OS=Homo sapiens OX=9606 GN=AGBL5 PE=1 SV=1
18	Q68EI3	9.34e-35	145	885	0.094	0.106	CBPC5_DANRE Cytosolic carboxypeptidase-like protein 5 OS=Danio rerio OX=7955 GN=agbl5 PE=2 SV=1
19	Q383Q1	3.67e-32	138	1192	0.113	0.095	Q383Q1_TRYB2 Zinc carboxypeptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2050 PE=3 SV=1
20	Q583K9	7.40e-27	120	773	0.098	0.127	Q583K9_TRYB2 Cytosolic carboxypeptidase-like protein 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.130 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18027 Pepdidase_M14_N	2.3e-17	74.5	Cytosolic carboxypeptidase N-terminal domain
2	PF00246 Peptidase_M14	2.4e-13	62.2	Zinc carboxypeptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000016009

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000019420	0.724	Complement component 3
2	61853.ENSNLEP00000012432	0.562	G1 to S phase transition 1
3	61853.ENSNLEP00000000229	0.555	Belongs to the ubiquitin-conjugating enzyme family.
4	61853.ENSNLEP00000015535	0.555	Ubiquitin-conjugating enzyme E2L 6
5	61853.ENSNLEP00000022536	0.555	Ubiquitin conjugating enzyme E2 L5, pseudogene
6	61853.ENSNLEP00000005120	0.546	Uncharacterized protein
7	61853.ENSNLEP00000019796	0.531	Uncharacterized protein
8	61853.ENSNLEP00000011335	0.527	Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyl diphosphate specific)
9	61853.ENSNLEP00000014628	0.524	Kelch domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004181	1.000	metallocarboxypeptidase activity
GO:0005488	0.827	binding
GO:0005515	0.660	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:1901564	0.998	organonitrogen compound metabolic process
GO:0019538	0.994	protein metabolic process
GO:0018200	0.976	peptidyl-glutamic acid modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.925	organelle
GO:0043229	0.900	intracellular organelle
GO:0043227	0.892	membrane-bounded organelle
GO:0032991	0.493	protein-containing complex
GO:0043231	0.389	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.17.-	1.000	Metallocarboxypeptidases.

[back to server]