StarFunc result for job id Q8NEN9

User Input

>input (1154 residues)
MGLLLMILASAVLGSFLTLLAQFFLLYRRQPEPPADEAARAGEGFRYIKPVPGLLLREYL
YGGGRDEEPSGAAPEGGATPTAAPETPAPPTRETCYFLNATILFLFRELRDTALTRRWVT
KKIKVEFEELLQTKTAGRLLEGLSLRDVFLGETVPFIKTIRLVRPVVPSATGEPDGPEGE
ALPAACPEELAFEAEVEYNGGFHLAIDVDLVFGKSAYLFVKLSRVVGRLRLVFTRVPFTH
WFFSFVEDPLIDFEVRSQFEGRPMPQLTSIIVNQLKKIIKRKHTLPNYKIRFKPFFPYQT
LQGFEEDEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLELSSSVWEEKQ
RSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDRLIAIG
GVKITSTLQVLKLIKQAGDRVLVYYERPVGQSNQGAVLQDNFGQLEENFLSSSCQSGYEE
EAAGLTVDTESRELDSEFEDLASDVRAQNEFKDEAQSLSHSPKRVPTTLSIKPLGAISPV
LNRKLAVGSHPLPPKIQSKDGNKPPPLKTSEITDPAQVSKPTQGSAFKPPVPPRPQAKVP
LPSADAPNQAEPDVLVEKPEKVVPPPLVDKSAEKQAKNVDAIDDAAAPKQFLAKQEVAKD
VTSETSCPTKDSSDDRQTWESSEILYRNKLGKWTRTRASCLFDIEACHRYLNIALWCRDP
FKLGGLICLGHVSLKLEDVALGCLATSNTEYLSKLRLEAPSPKAIVTRTALRNLSMQKGF
NDKFCYGDITIHFKYLKEGESDHHVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTENK
HSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETSVCGATDRRIDR
TLKNLRLEGQETLLGLPPRVDAEASKSVNKTTGLTRHIINTSSRLLNLRQVSKTRLSEPG
TDLVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKEIG
RDLYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNSLVREEKETTDTRKKSLLSAALAKS
GERLQALTLLMIHYRAGIEDIETLESLSLDQHSKKISKYTDDTEEDLDNEISQLIDSQPF
SSISDDLFGPSESV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B9EJ80	0.533	0.536	0.000	1147	0.863	0.868	B9EJ80.pdb.gz	PDZD8_MOUSE PDZ domain-containing protein 8 OS=Mus musculus OX=10090 GN=Pdzd8 PE=1 SV=1
2	AFDB:Q8NEN9	1.000	1.000	0.000	1154	1.000	1.000	Q8NEN9.pdb.gz	PDZD8_HUMAN PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1
3	AFDB:Q9JLU4	0.080	0.056	1.337E-5	1740	0.137	0.091	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
4	AFDB:A0A0R4IEP0	0.079	0.088	1.841E-5	955	0.081	0.097	A0A0R4IEP0.pdb.gz
5	AFDB:Q9ULL8	0.072	0.056	3.494E-5	1493	0.108	0.084	Q9ULL8.pdb.gz	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
6	PDB:7p73A	0.070	0.182	4.202E-5	420	0.016	0.045	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
7	PDB:5n7dA	0.072	0.178	5.788E-5	423	0.016	0.045	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
8	PDB:7pc3A	0.072	0.198	6.793E-5	405	0.016	0.044	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
9	PDB:7pcbA	0.070	0.189	1.222E-4	415	0.017	0.048	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
10	AFDB:Q80Z38	0.081	0.065	2.387E-4	1476	0.107	0.083	Q80Z38.pdb.gz	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
11	PDB:5gydC	0.113	0.494	3.194E-4	228	0.030	0.154	5gydC.pdb.gz
12	PDB:7qqnC	0.068	0.180	4.399E-4	414	0.016	0.043	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:2l4tA	0.072	0.506	7.914E-4	124	0.025	0.234	2l4tA.pdb.gz	Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L.
14	PDB:7p70A	0.074	0.192	8.805E-4	407	0.016	0.044	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:7qqmA	0.071	0.185	1.502E-3	413	0.017	0.048	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	AFDB:Q9P227	0.070	0.056	1.631E-3	1491	0.101	0.078	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
17	AFDB:Q9QXN0	0.077	0.047	2.369E-3	1986	0.084	0.049	Q9QXN0.pdb.gz	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
18	PDB:2xkxA	0.068	0.107	2.701E-3	721	0.018	0.029	2xkxA.pdb.gz
19	AFDB:Q9VUE8	0.073	0.034	4.262E-3	2637	0.096	0.042	Q9VUE8.pdb.gz	Q9VUE8_DROME Big bang, isoform C OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=2
20	AFDB:P49796	0.071	0.069	6.192E-3	1198	0.111	0.107	P49796.pdb.gz	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B9EJ80	0.0	2022	1147	0.867	0.873	PDZD8_MOUSE PDZ domain-containing protein 8 OS=Mus musculus OX=10090 GN=Pdzd8 PE=1 SV=1
2	Q8NEN9	0.0	2370	1154	1.000	1.000	PDZD8_HUMAN PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1
3	Q9VYR9	1.79e-49	193	1037	0.116	0.129	Q9VYR9_DROME LD34222p OS=Drosophila melanogaster OX=7227 GN=Pdzd8 PE=2 SV=1
4	Q9Z1N3	2.02e-08	61.6	2626	0.022	0.010	MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus OX=10116 GN=Myo9a PE=1 SV=1
5	B2RTY4	3.05e-08	60.8	2548	0.022	0.010	MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A PE=1 SV=2
6	Q8C170	3.23e-08	60.8	2542	0.022	0.010	MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus OX=10090 GN=Myo9a PE=1 SV=2
7	E7EZG2	7.20e-07	56.2	2522	0.019	0.009	MY9AA_DANRE Unconventional myosin-IXAa OS=Danio rerio OX=7955 GN=myo9aa PE=3 SV=1
8	E7F3F0	1.52e-06	55.5	2286	0.019	0.010	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
9	Q22744	1.18e-05	52.0	615	0.016	0.031	RASF1_CAEEL Ras association domain-containing protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rsf-1 PE=1 SV=1
10	J9W1R7	7.59e-05	49.7	1086	0.019	0.020	J9W1R7_CRYNH protein kinase C OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_01845 PE=3 SV=1
11	P83099	3.72e-04	47.0	671	0.018	0.031	KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster OX=7227 GN=Pkcdelta PE=2 SV=3
12	Q965N4	4.19e-04	46.6	421	0.016	0.043	Q965N4_CAEEL Chimerin 2 OS=Caenorhabditis elegans OX=6239 GN=chin-1 PE=1 SV=3
13	Q8TDF6	5.10e-04	46.6	673	0.016	0.027	GRP4_HUMAN RAS guanyl-releasing protein 4 OS=Homo sapiens OX=9606 GN=RASGRP4 PE=1 SV=2
14	P09216	6.02e-04	46.6	737	0.016	0.024	KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus OX=10116 GN=Prkce PE=1 SV=1
15	P16054	6.34e-04	46.2	737	0.016	0.024	KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus OX=10090 GN=Prkce PE=1 SV=1
16	L7RTI5	6.39e-04	46.2	737	0.016	0.024	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
17	Q02156	6.39e-04	46.2	737	0.016	0.024	KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=1 SV=1
18	B8A467	6.67e-04	46.2	738	0.016	0.024	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
19	O45818	6.67e-04	46.6	1070	0.018	0.020	DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans OX=6239 GN=dkf-2 PE=1 SV=4
20	Q865P3	7.30e-04	45.8	518	0.029	0.064	NHRF3_RABIT Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Oryctolagus cuniculus OX=9986 GN=PDZK1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.00052	31.2	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF04495 GRASP55_65	27	16.5	GRASP55/65 PDZ-like domain
3	PF00595 PDZ	0.00015	33.3	PDZ domain
4	PF13180 PDZ_2	0.0021	29.7	PDZ domain
5	PF17820 PDZ_6	1.4e-08	45.8	PDZ domain
6	PF02163 Peptidase_M50	0.032	25.1	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334642

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
2	9606.ENSP00000265062	0.821	Ras-related protein Rab-7a
3	9606.ENSP00000338885	0.731	Phospholipid transfer protein C2CD2L
4	9606.ENSP00000260385	0.682	Regulator of microtubule dynamics protein 3
5	9606.ENSP00000265388	0.666	Transportin-3
6	9606.ENSP00000266679	0.611	Cleavage and polyadenylation specificity factor subunit 6
7	9606.ENSP00000363228	0.596	RNA-binding protein 12
8	9606.ENSP00000417175	0.562	Vesicle-associated membrane protein-associated protein B/C
9	9606.ENSP00000251527	0.558	Extended synaptotagmin-2
10	9606.ENSP00000409382	0.515	EF-hand calcium-binding domain-containing protein 4B
11	9606.ENSP00000306528	0.512	Desumoylating isopeptidase 2
12	9606.ENSP00000283195	0.511	E3 SUMO-protein ligase RanBP2
13	9606.ENSP00000298472	0.507	Synaptic vesicular amine transporter
14	9606.ENSP00000369531	0.505	Ubiquilin-like protein
15	9606.ENSP00000256366	0.504	Synaptojanin-2-binding protein
16	9606.ENSP00000397312	0.500	Leucine-rich repeat neuronal protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0022406	0.981	membrane docking
GO:0006874	0.981	intracellular calcium ion homeostasis
GO:0051640	0.977	organelle localization
GO:0051560	0.972	mitochondrial calcium ion homeostasis
GO:0016043	0.971	cellular component organization
GO:0140056	0.967	organelle localization by membrane tethering
GO:0065007	0.947	biological regulation
GO:0050789	0.936	regulation of biological process
GO:0006996	0.844	organelle organization
GO:0050794	0.344	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.998	endoplasmic reticulum membrane
GO:0044233	0.996	mitochondria-associated endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]