StarFunc result for job id Q8NEP3

User Input

>input (725 residues)
MHPEPSEPATGGAAELDCAQEPGVEESAGDHGSAGRGGCKEEINDPKEICVGSSDTSYHS
QQKQSGDNGSGGHFAHPREDREDRGPRMTKSSLQKLCKQHKLYITPALNDTLYLHFKGFD
RIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNL
SNNYIKTIENLSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNKLSDPEILSI
LESMPDLRVLNLMGNPVIRQIPNYRRTVTVRLKHLTYLDDRPVFPKDRACAEAWARGGYA
AEKEERQQWESRERKKITDSIEALAMIKQRAEERKRQRESQERGEMTSSDDGENVPASAE
GKEEPPGDRETRQKMELFVKESFEAKDELCPEKPSGEEPPVEAKREDGGPEPEGTLPAET
LLLSSPVEVKGEDGDGEPEGTLPAEAPPPPPPVEVKGEDGDQEPEGTLPAETLLLSPPVK
VKGEDGDREPEGTLPAEAPPPPPLGAAREEPTPQAVATEGVFVTELDGTRTEDLETIRLE
TKETFCIDDLPDLEDDDETGKSLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPT
DTLSNIFAVSKDTSKAARVPFTDIFKKEAKRDLEIRKQDTKSPRPLIQELSDEDPSGQLL
MPPTCQRDAAPLTSSGDRDSDFLAASSPVPTESAATPPETCVGVAQPSQALPTWDLTAFP
APKAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJN4	0.491	0.491	2.056E-96	725	1.000	1.000	A0A140VJN4.pdb.gz	A0A140VJN4_HUMAN Dynein axonemal assembly factor 1 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q8INT5	0.340	0.169	1.093E-28	1483	0.258	0.126	Q8INT5.pdb.gz	DAAF1_DROME Dynein axonemal assembly factor 1 homolog OS=Drosophila melanogaster OX=7227 GN=dtr PE=2 SV=2
3	AFDB:Q09JZ4	0.327	0.541	4.051E-28	432	0.189	0.317	Q09JZ4.pdb.gz	DAAF1_CHLRE Leucine-rich repeat-containing protein ODA7 OS=Chlamydomonas reinhardtii OX=3055 GN=ODA7 PE=1 SV=1
4	PDB:6hkwA	0.143	0.287	1.568E-11	306	0.090	0.212	6hkwA.pdb.gz
5	PDB:1m9sA	0.227	0.311	1.364E-8	523	0.069	0.096	1m9sA.pdb.gz
6	PDB:7tvfD	0.210	0.286	5.639E-8	515	0.068	0.095	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
7	PDB:7lt9A	0.232	0.609	1.086E-7	251	0.063	0.183	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
8	AFDB:B0M0P8	0.201	0.069	1.369E-7	2356	0.137	0.042	B0M0P8.pdb.gz	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
9	PDB:3jb9j	0.168	0.703	6.576E-7	160	0.054	0.244	3jb9j.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
10	PDB:7p5vB	0.198	0.197	2.185E-6	732	0.059	0.059	7p5vB.pdb.gz
11	PDB:7a5pW	0.173	0.662	7.261E-6	174	0.058	0.241	7a5pW.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
12	AFDB:Q9SN46	0.157	0.137	1.417E-5	857	0.149	0.126	Q9SN46.pdb.gz	LRX5_ARATH Leucine-rich repeat extensin-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=LRX5 PE=2 SV=2
13	PDB:1dceA	0.140	0.171	1.559E-5	567	0.048	0.062	1dceA.pdb.gz	Crystal structure of Rab geranylgeranyltransferase at 2.0 A resolution.
14	PDB:6g90W	0.169	0.664	3.535E-5	170	0.052	0.224	6g90W.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
15	AFDB:Q9XIB6	0.167	0.148	3.996E-5	847	0.152	0.130	Q9XIB6.pdb.gz	PLRX2_ARATH Pollen-specific leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=PEX2 PE=1 SV=1
16	PDB:4cc4A	0.172	0.421	4.398E-5	265	0.054	0.147	4cc4A.pdb.gz
17	AFDB:Q9VFY9	0.184	0.124	3.011E-4	1141	0.154	0.098	Q9VFY9.pdb.gz	Q9VFY9_DROME 2mit, isoform A OS=Drosophila melanogaster OX=7227 GN=2mit PE=4 SV=2
18	AFDB:Q9FHI4	0.163	0.109	8.409E-3	1167	0.139	0.087	Q9FHI4.pdb.gz	Q9FHI4_ARATH Leucine-rich repeat (LRR) family protein OS=Arabidopsis thaliana OX=3702 GN=MFC19.19 PE=1 SV=1
19	AFDB:A2API8	0.077	0.063	2.014E-2	921	0.146	0.115	A2API8.pdb.gz	A2API8_MOUSE Paralemmin A kinase anchor protein OS=Mus musculus OX=10090 GN=Pakap PE=1 SV=1
20	AFDB:E1C2F2	0.059	0.062	2.372E-2	691	0.095	0.100	E1C2F2.pdb.gz	E1C2F2_CHICK Pinin OS=Gallus gallus OX=9031 GN=PNN PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJN4	0.0	1469	725	1.000	1.000	A0A140VJN4_HUMAN Dynein axonemal assembly factor 1 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q8NEP3	0.0	1469	725	1.000	1.000	DAAF1_HUMAN Dynein axonemal assembly factor 1 OS=Homo sapiens OX=9606 GN=DNAAF1 PE=1 SV=5
3	Q7ZV84	3.54e-119	370	555	0.233	0.305	DAAF1_DANRE Dynein axonemal assembly factor 1 OS=Danio rerio OX=7955 GN=dnaaf1 PE=2 SV=2
4	Q8INT5	6.81e-79	278	1483	0.181	0.088	DAAF1_DROME Dynein axonemal assembly factor 1 homolog OS=Drosophila melanogaster OX=7227 GN=dtr PE=2 SV=2
5	Q09JZ4	4.98e-65	224	432	0.150	0.252	DAAF1_CHLRE Leucine-rich repeat-containing protein ODA7 OS=Chlamydomonas reinhardtii OX=3055 GN=ODA7 PE=1 SV=1
6	Q382D9	1.08e-41	159	440	0.135	0.223	Q382D9_TRYB2 Leucine-rich repeat-containing protein ODA7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5550 PE=4 SV=1
7	Q57VR9	1.68e-23	107	608	0.081	0.097	Q57VR9_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.29K4.600 PE=4 SV=1
8	Q3UM45	8.59e-16	82.0	361	0.092	0.186	PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2
9	A8IVX2	8.73e-16	83.2	524	0.086	0.118	DRC3_CHLRE Dynein regulatory complex subunit 3 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC3 PE=1 SV=1
10	Q15435	1.52e-15	81.3	360	0.087	0.175	PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1
11	A2AL36	3.10e-15	82.8	2334	0.101	0.031	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
12	Q8IUZ0	2.30e-14	79.3	686	0.105	0.111	LRC49_HUMAN Leucine-rich repeat-containing protein 49 OS=Homo sapiens OX=9606 GN=LRRC49 PE=1 SV=2
13	Q7Z7A1	4.67e-14	79.0	2325	0.103	0.032	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
14	Q9VL65	9.30e-14	77.0	566	0.090	0.115	Q9VL65_DROME TbCMF46 OS=Drosophila melanogaster OX=7227 GN=TbCMF46 PE=4 SV=2
15	Q5AHH6	2.25e-13	74.7	374	0.079	0.152	Q5AHH6_CANAL Type 1 protein phosphatase-activating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SDS22 PE=4 SV=1
16	Q91YK0	8.08e-13	74.3	686	0.090	0.095	LRC49_MOUSE Leucine-rich repeat-containing protein 49 OS=Mus musculus OX=10090 GN=Lrrc49 PE=1 SV=1
17	Q9VEK8	2.32e-12	71.2	326	0.076	0.169	Q9VEK8_DROME GH07711p OS=Drosophila melanogaster OX=7227 GN=sds22 PE=1 SV=1
18	Q9D5E4	3.00e-12	72.0	523	0.086	0.119	DRC3_MOUSE Dynein regulatory complex subunit 3 OS=Mus musculus OX=10090 GN=Drc3 PE=1 SV=1
19	Q9H069	3.66e-12	71.6	523	0.080	0.111	DRC3_HUMAN Dynein regulatory complex subunit 3 OS=Homo sapiens OX=9606 GN=DRC3 PE=1 SV=2
20	Q9D5S7	4.17e-12	72.0	820	0.080	0.071	LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus OX=10090 GN=Lrguk PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12799 LRR_4	3.2e-10	51.3	Leucine Rich repeats (2 copies)
2	PF13855 LRR_8	0.00027	31.9	Leucine rich repeat
3	PF14580 LRR_9	1e-10	52.9	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367815

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296218	0.906	Axonemal dynein light intermediate polypeptide 1
2	9606.ENSP00000400252	0.898	Dynein intermediate chain 2, axonemal
3	9606.ENSP00000231749	0.893	Zinc finger MYND domain-containing protein 10
4	9606.ENSP00000265104	0.853	Dynein heavy chain 5, axonemal
5	9606.ENSP00000298292	0.832	Protein kintoun
6	9606.ENSP00000436975	0.809	Dynein assembly factor 3, axonemal
7	9606.ENSP00000349658	0.791	X-prolyl aminopeptidase 3
8	9606.ENSP00000297440	0.768	Dynein assembly factor 5, axonemal
9	9606.ENSP00000380679	0.761	Coiled-coil domain-containing protein 40
10	9606.ENSP00000229554	0.760	Radial spoke head protein 4 homolog A
11	9606.ENSP00000391692	0.754	Coiled-coil domain containing 103
12	9606.ENSP00000391869	0.752	annotation not available
13	9606.ENSP00000475939	0.751	Dynein heavy chain 11, axonemal
14	9606.ENSP00000480538	0.745	Dynein intermediate chain 1, axonemal
15	9606.ENSP00000405708	0.742	Coiled-coil domain-containing protein 39
16	9606.ENSP00000361238	0.735	Radial spoke head 9 homolog
17	9606.ENSP00000482968	0.732	Alstrom syndrome protein 1
18	9606.ENSP00000377668	0.727	Sulfite oxidase, mitochondrial
19	9606.ENSP00000311899	0.726	Dynein assembly factor with WDR repeat domains 1
20	9606.ENSP00000441930	0.719	Protein PIH1D3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070840	0.992	dynein complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0003341	0.982	cilium movement
GO:0070286	0.981	axonemal dynein complex assembly
GO:0007368	0.980	determination of left/right symmetry
GO:0003351	0.969	epithelial cilium movement involved in extracellular fluid movement
GO:0001947	0.969	heart looping
GO:0032886	0.959	regulation of microtubule-based process
GO:0061008	0.947	hepaticobiliary system development
GO:0044458	0.945	motile cilium assembly
GO:0060287	0.941	epithelial cilium movement involved in determination of left/right asymmetry
GO:0055123	0.938	digestive system development
GO:0031016	0.933	pancreas development
GO:0003352	0.928	regulation of cilium movement
GO:0048732	0.906	gland development
GO:0001889	0.896	liver development
GO:0060541	0.884	respiratory system development
GO:0030323	0.883	respiratory tube development
GO:0071907	0.878	determination of digestive tract left/right asymmetry
GO:0071910	0.866	determination of liver left/right asymmetry
GO:0030324	0.805	lung development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.998	plasma membrane
GO:0016604	0.997	nuclear body
GO:0016607	0.994	nuclear speck
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005929	0.941	cilium
GO:0005856	0.924	cytoskeleton
GO:0099568	0.879	cytoplasmic region
GO:0005930	0.865	axoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]