StarFunc result for job id Q8NER5

User Input

>input (493 residues)
MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVI
KSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITV
PVCLLSIAAMLTVWACQGRQCSYRKKKRPNVEEPLSECNLVNAGKTLKDLIYDVTASGSG
SGLPLLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQ
TVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLALSIA
SGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQN
PKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYD
MVPSDPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKK
TISQLCVKEDCKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70539	0.719	0.719	1.533E-91	493	0.925	0.925	P70539.pdb.gz	ACV1C_RAT Activin receptor type-1C OS=Rattus norvegicus OX=10116 GN=Acvr1c PE=1 SV=1
2	AFDB:P36896	0.677	0.661	1.495E-74	505	0.643	0.628	P36896.pdb.gz	ACV1B_HUMAN Activin receptor type-1B OS=Homo sapiens OX=9606 GN=ACVR1B PE=1 SV=1
3	AFDB:B3DJ37	0.787	0.770	2.217E-74	505	0.637	0.622	B3DJ37.pdb.gz
4	AFDB:P36897	0.692	0.678	4.614E-74	503	0.661	0.648	P36897.pdb.gz	TGFR1_HUMAN TGF-beta receptor type-1 OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
5	AFDB:A1Z7L9	0.677	0.558	5.895E-65	601	0.509	0.418	A1Z7L9.pdb.gz	A1Z7L9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
6	AFDB:A1Z7L8	0.672	0.534	1.169E-63	622	0.503	0.399	A1Z7L8.pdb.gz	A1Z7L8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
7	AFDB:M0R3J4	0.719	0.707	1.550E-63	502	0.499	0.490	M0R3J4.pdb.gz	M0R3J4_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=2
8	AFDB:A0A0R4IZG7	0.676	0.625	2.881E-63	535	0.491	0.452	A0A0R4IZG7.pdb.gz
9	AFDB:F1NTD3	0.689	0.677	5.667E-63	502	0.505	0.496	F1NTD3.pdb.gz	F1NTD3_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1B PE=3 SV=1
10	AFDB:F1P3H0	0.669	0.620	7.512E-63	533	0.515	0.477	F1P3H0.pdb.gz	F1P3H0_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1A PE=3 SV=1
11	PDB:1k9aB	0.444	0.494	8.923E-17	441	0.138	0.154	1k9aB.pdb.gz
12	PDB:8dksA	0.420	0.706	2.915E-16	283	0.146	0.254	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
13	PDB:2h8hA	0.434	0.478	1.127E-15	445	0.152	0.169	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:4zhxA	0.438	0.522	1.873E-15	409	0.140	0.169	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
15	PDB:5u6yA	0.448	0.479	3.110E-15	459	0.124	0.133	5u6yA.pdb.gz
16	PDB:2bujA	0.434	0.717	3.290E-15	291	0.128	0.216	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
17	PDB:4rerA	0.435	0.465	4.122E-15	459	0.126	0.135	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:5ufuA	0.434	0.568	4.361E-15	369	0.136	0.182	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:1unlA	0.427	0.697	4.614E-15	292	0.124	0.209	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:6s73A	0.430	0.751	5.781E-15	269	0.124	0.227	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DY26	0.0	639	434	0.623	0.707	B4DY26_HUMAN receptor protein serine/threonine kinase OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
2	O46680	0.0	658	499	0.661	0.653	TGFR1_BOVIN TGF-beta receptor type-1 OS=Bos taurus OX=9913 GN=TGFBR1 PE=2 SV=1
3	P36896	0.0	650	505	0.655	0.640	ACV1B_HUMAN Activin receptor type-1B OS=Homo sapiens OX=9606 GN=ACVR1B PE=1 SV=1
4	P36897	0.0	661	503	0.661	0.648	TGFR1_HUMAN TGF-beta receptor type-1 OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
5	P70539	0.0	937	493	0.899	0.899	ACV1C_RAT Activin receptor type-1C OS=Rattus norvegicus OX=10116 GN=Acvr1c PE=1 SV=1
6	P79689	0.0	647	505	0.637	0.622	P79689_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=axis PE=2 SV=1
7	P80202	0.0	649	505	0.653	0.638	ACV1B_RAT Activin receptor type-1B OS=Rattus norvegicus OX=10116 GN=Acvr1b PE=2 SV=1
8	P80204	0.0	674	501	0.694	0.683	TGFR1_RAT TGF-beta receptor type-1 OS=Rattus norvegicus OX=10116 GN=Tgfbr1 PE=1 SV=1
9	Q06900	0.0	644	503	0.655	0.642	Q06900_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=ChALK5 PE=2 SV=2
10	Q5T7S2	0.0	661	503	0.661	0.648	Q5T7S2_HUMAN receptor protein serine/threonine kinase OS=Homo sapiens OX=9606 GN=TGFBR1 PE=3 SV=1
11	Q61271	0.0	647	505	0.651	0.636	ACV1B_MOUSE Activin receptor type-1B OS=Mus musculus OX=10090 GN=Acvr1b PE=1 SV=1
12	Q64729	0.0	673	503	0.686	0.672	TGFR1_MOUSE TGF-beta receptor type-1 OS=Mus musculus OX=10090 GN=Tgfbr1 PE=1 SV=1
13	Q8K348	0.0	938	493	0.897	0.897	ACV1C_MOUSE Activin receptor type-1C OS=Mus musculus OX=10090 GN=Acvr1c PE=2 SV=3
14	Q8NER5	0.0	1025	493	1.000	1.000	ACV1C_HUMAN Activin receptor type-1C OS=Homo sapiens OX=9606 GN=ACVR1C PE=1 SV=1
15	Q7YU60	1.74e-175	508	595	0.527	0.437	Q7YU60_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=2 SV=1
16	A1Z7L9	9.44e-174	503	601	0.519	0.426	A1Z7L9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
17	Q23975	1.68e-173	503	601	0.519	0.426	Q23975_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=2 SV=1
18	A1Z7L8	1.53e-165	483	622	0.517	0.410	A1Z7L8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
19	Q1RLX1	4.53e-160	466	527	0.481	0.450	Q1RLX1_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=zgc:136731 PE=2 SV=1
20	B3DJG0	5.21e-160	466	526	0.481	0.451	B3DJG0_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=bmpr1a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01064 Activin_recp	3.7e-07	42.3	Activin types I and II receptor domain
2	PF00069 Pkinase	2.2e-27	107.6	Protein kinase domain
3	PF17667 Pkinase_fungal	36	14.6	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	2e-29	114.2	Protein tyrosine and serine/threonine kinase
5	PF08515 TGF_beta_GS	6.3e-10	49.7	Transforming growth factor beta type I GS-motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243349

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262160	0.980	Mothers against decapentaplegic homolog 2
2	9606.ENSP00000296145	0.978	Teratocarcinoma-derived growth factor 1
3	9606.ENSP00000331745	0.975	Growth/differentiation factor 3
4	9606.ENSP00000295228	0.974	Inhibin beta B chain
5	9606.ENSP00000332973	0.968	Mothers against decapentaplegic homolog 3
6	9606.ENSP00000323155	0.945	DAN domain family member 5
7	9606.ENSP00000263640	0.930	Activin receptor type-1
8	9606.ENSP00000247005	0.916	Growth differentiation factor 1
9	9606.ENSP00000370297	0.909	Cerberus
10	9606.ENSP00000287139	0.902	Nodal homolog
11	9606.ENSP00000341551	0.902	Mothers against decapentaplegic homolog 4
12	9606.ENSP00000242208	0.898	Inhibin beta A chain
13	9606.ENSP00000340361	0.893	Activin receptor type-2B
14	9606.ENSP00000241416	0.891	Activin receptor type-2A
15	9606.ENSP00000355785	0.786	Left-right determination factor 2
16	9606.ENSP00000257868	0.784	Growth/differentiation factor 11
17	9606.ENSP00000272134	0.760	Left-right determination factor 1
18	9606.ENSP00000308716	0.758	Inhibin beta C chain
19	9606.ENSP00000266646	0.756	Inhibin beta E chain
20	9606.ENSP00000245451	0.743	Bone morphogenetic protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004675	0.997	transmembrane receptor protein serine/threonine kinase activity
GO:0019838	0.996	growth factor binding
GO:0043167	0.992	ion binding
GO:1901363	0.759	heterocyclic compound binding
GO:0097159	0.759	organic cyclic compound binding
GO:0048185	0.742	activin binding
GO:0005102	0.558	signaling receptor binding
GO:0032559	0.536	adenyl ribonucleotide binding
GO:0005524	0.527	ATP binding
GO:0050431	0.346	transforming growth factor beta binding
GO:0017002	0.345	activin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0007275	0.985	multicellular organism development
GO:0048522	0.978	positive regulation of cellular process
GO:0080090	0.948	regulation of primary metabolic process
GO:0007167	0.947	enzyme-linked receptor protein signaling pathway
GO:0007178	0.944	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009719	0.939	response to endogenous stimulus
GO:0009893	0.930	positive regulation of metabolic process
GO:0048519	0.928	negative regulation of biological process
GO:0048583	0.886	regulation of response to stimulus
GO:0051246	0.885	regulation of protein metabolic process
GO:0031323	0.884	regulation of cellular metabolic process
GO:0009966	0.880	regulation of signal transduction
GO:0071495	0.878	cellular response to endogenous stimulus
GO:0048523	0.878	negative regulation of cellular process
GO:0010604	0.875	positive regulation of macromolecule metabolic process
GO:0010468	0.871	regulation of gene expression
GO:0071363	0.868	cellular response to growth factor stimulus
GO:0009889	0.866	regulation of biosynthetic process
GO:0071704	0.822	organic substance metabolic process
GO:0051173	0.822	positive regulation of nitrogen compound metabolic process
GO:0044237	0.817	cellular metabolic process
GO:0044238	0.804	primary metabolic process
GO:0031326	0.802	regulation of cellular biosynthetic process
GO:0019219	0.802	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.799	regulation of macromolecule biosynthetic process
GO:0051252	0.786	regulation of RNA metabolic process
GO:1903506	0.777	regulation of nucleic acid-templated transcription
GO:0006355	0.765	regulation of DNA-templated transcription
GO:0051239	0.754	regulation of multicellular organismal process
GO:0031325	0.752	positive regulation of cellular metabolic process
GO:0016310	0.751	phosphorylation
GO:0006807	0.746	nitrogen compound metabolic process
GO:0043170	0.724	macromolecule metabolic process
GO:0048731	0.720	system development
GO:0048513	0.715	animal organ development
GO:0010647	0.701	positive regulation of cell communication
GO:0023056	0.698	positive regulation of signaling
GO:0050793	0.682	regulation of developmental process
GO:0019538	0.677	protein metabolic process
GO:0048869	0.676	cellular developmental process
GO:0030154	0.671	cell differentiation
GO:0090092	0.601	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0006468	0.584	protein phosphorylation
GO:0032924	0.579	activin receptor signaling pathway
GO:0009891	0.571	positive regulation of biosynthetic process
GO:0051247	0.540	positive regulation of protein metabolic process
GO:0031328	0.506	positive regulation of cellular biosynthetic process
GO:0048584	0.495	positive regulation of response to stimulus
GO:1902680	0.495	positive regulation of RNA biosynthetic process
GO:0051174	0.485	regulation of phosphorus metabolic process
GO:0019220	0.479	regulation of phosphate metabolic process
GO:1903508	0.479	positive regulation of nucleic acid-templated transcription
GO:0009967	0.475	positive regulation of signal transduction
GO:0090100	0.465	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010562	0.460	positive regulation of phosphorus metabolic process
GO:0045893	0.458	positive regulation of DNA-templated transcription
GO:0042127	0.453	regulation of cell population proliferation
GO:0031399	0.442	regulation of protein modification process
GO:0042325	0.437	regulation of phosphorylation
GO:0042221	0.434	response to chemical
GO:0031401	0.432	positive regulation of protein modification process
GO:0051240	0.427	positive regulation of multicellular organismal process
GO:0051094	0.423	positive regulation of developmental process
GO:0071560	0.421	cellular response to transforming growth factor beta stimulus
GO:0045595	0.420	regulation of cell differentiation
GO:0009653	0.416	anatomical structure morphogenesis
GO:0007179	0.409	transforming growth factor beta receptor signaling pathway
GO:0009892	0.400	negative regulation of metabolic process
GO:0009888	0.398	tissue development
GO:0001932	0.397	regulation of protein phosphorylation
GO:0010605	0.343	negative regulation of macromolecule metabolic process
GO:0023057	0.340	negative regulation of signaling
GO:0010648	0.338	negative regulation of cell communication
GO:2000026	0.337	regulation of multicellular organismal development
GO:0006357	0.332	regulation of transcription by RNA polymerase II
GO:0065009	0.304	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.986	protein-containing complex
GO:0043235	0.687	receptor complex
GO:0005622	0.653	intracellular anatomical structure
GO:0043226	0.437	organelle
GO:0098802	0.423	plasma membrane signaling receptor complex
GO:0043227	0.421	membrane-bounded organelle
GO:0005737	0.415	cytoplasm
GO:1990234	0.362	transferase complex
GO:0061695	0.340	transferase complex, transferring phosphorus-containing groups
GO:1902554	0.313	serine/threonine protein kinase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	0.997	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.997	receptor protein serine/threonine kinase.

[back to server]