StarFunc result for job id Q8NES3

User Input

>input (379 residues)
MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSLAGPAGAAPAPGLGAA
AAAPGALVRDVHSLSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVK
TTKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCK
MAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERV
SENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDCTIGYIVEAL
LGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFR
SIHCHLYPDTPWCPRTAIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NES3	1.000	1.000	7.961E-79	379	1.000	1.000	Q8NES3.pdb.gz	LFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Homo sapiens OX=9606 GN=LFNG PE=1 SV=2
2	AFDB:O09010	0.864	0.867	5.704E-69	378	0.889	0.892	O09010.pdb.gz	LFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Mus musculus OX=10090 GN=Lfng PE=1 SV=1
3	AFDB:Q8JHF2	0.777	0.787	6.671E-54	374	0.631	0.639	Q8JHF2.pdb.gz	LFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Danio rerio OX=7955 GN=lfng PE=2 SV=2
4	AFDB:Q6KFX9	0.694	0.726	1.260E-47	362	0.546	0.572	Q6KFX9.pdb.gz	RFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Danio rerio OX=7955 GN=rfng PE=2 SV=1
5	AFDB:O00587	0.703	0.829	5.246E-45	321	0.485	0.573	O00587.pdb.gz	MFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Homo sapiens OX=9606 GN=MFNG PE=1 SV=2
6	AFDB:Q9R1U9	0.696	0.788	1.210E-44	334	0.512	0.581	Q9R1U9.pdb.gz	RFNG_RAT Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Rattus norvegicus OX=10116 GN=Rfng PE=2 SV=1
7	AFDB:O09008	0.695	0.819	1.526E-42	321	0.485	0.573	O09008.pdb.gz	MFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Mus musculus OX=10090 GN=Mfng PE=1 SV=1
8	AFDB:Q24342	0.679	0.625	1.258E-38	412	0.398	0.367	Q24342.pdb.gz	FNG_DROME Fringe glycosyltransferase OS=Drosophila melanogaster OX=7227 GN=fng PE=1 SV=1
9	AFDB:Q86X52	0.440	0.218	3.922E-13	802	0.198	0.094	Q86X52.pdb.gz	CHSS1_HUMAN Chondroitin sulfate synthase 1 OS=Homo sapiens OX=9606 GN=CHSY1 PE=1 SV=3
10	AFDB:Q5DTK1	0.463	0.214	1.149E-12	884	0.177	0.076	Q5DTK1.pdb.gz	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3
11	PDB:7jhiC	0.431	0.486	2.046E-8	331	0.127	0.145	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:4fixA	0.258	0.170	1.251E-4	629	0.087	0.052	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
13	PDB:2gamC	0.390	0.394	1.589E-4	374	0.129	0.131	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
14	PDB:3k8dA	0.256	0.360	3.253E-4	246	0.077	0.118	3k8dA.pdb.gz	Structure-based mechanism of CMP-2-keto-3-deoxymanno-octulonic acid synthetase: convergent evolution of a sugar-activating enzyme with DNA/RNA polymerases
15	PDB:3r2wC	0.249	0.216	7.071E-4	450	0.082	0.069	3r2wC.pdb.gz
16	PDB:7sckA	0.339	0.216	9.531E-4	642	0.095	0.056	7sckA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
17	PDB:6fxrA	0.311	0.183	1.012E-3	700	0.103	0.056	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
18	PDB:7sckB	0.299	0.205	1.631E-3	598	0.095	0.060	7sckB.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
19	PDB:4y63A	0.291	0.372	2.964E-3	282	0.103	0.138	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
20	PDB:7d72A	0.299	0.282	5.074E-3	407	0.069	0.064	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09010	0.0	655	378	0.889	0.892	LFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Mus musculus OX=10090 GN=Lfng PE=1 SV=1
2	Q8NES3	0.0	774	379	1.000	1.000	LFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Homo sapiens OX=9606 GN=LFNG PE=1 SV=2
3	Q8JHF2	2.93e-175	494	374	0.641	0.650	LFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe OS=Danio rerio OX=7955 GN=lfng PE=2 SV=2
4	Q6KFX9	8.86e-133	386	362	0.504	0.528	RFNG_DANRE Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Danio rerio OX=7955 GN=rfng PE=2 SV=1
5	O00587	9.04e-127	369	321	0.470	0.555	MFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Homo sapiens OX=9606 GN=MFNG PE=1 SV=2
6	O09008	2.12e-126	368	321	0.478	0.564	MFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Mus musculus OX=10090 GN=Mfng PE=1 SV=1
7	Q9R1U9	3.06e-125	365	334	0.464	0.527	RFNG_RAT Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Rattus norvegicus OX=10116 GN=Rfng PE=2 SV=1
8	O09009	1.88e-124	363	332	0.459	0.524	RFNG_MOUSE Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Mus musculus OX=10090 GN=Rfng PE=2 SV=1
9	Q24342	1.09e-88	275	412	0.398	0.367	FNG_DROME Fringe glycosyltransferase OS=Drosophila melanogaster OX=7227 GN=fng PE=1 SV=1
10	A0A068F5P3	2.24e-10	64.3	493	0.158	0.122	A0A068F5P3_DANRE Beta-1,3-glucosyltransferase precursor OS=Danio rerio OX=7955 GN=si:dkey-189i22.3 PE=2 SV=1
11	Q6Y288	8.75e-10	62.4	498	0.153	0.116	B3GLT_HUMAN Beta-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=B3GLCT PE=1 SV=2
12	A0A068F9P7	2.83e-08	57.8	496	0.148	0.113	A0A068F9P7_DANRE Beta-1,3-glucosyltransferase OS=Danio rerio OX=7955 GN=b3galtla PE=2 SV=1
13	D3ZRM3	4.16e-05	48.1	799	0.166	0.079	D3ZRM3_RAT Hexosyltransferase OS=Rattus norvegicus OX=10116 GN=Chsy1 PE=3 SV=3
14	Q6ZQ11	4.30e-04	44.7	800	0.166	0.079	CHSS1_MOUSE Chondroitin sulfate synthase 1 OS=Mus musculus OX=10090 GN=Chsy1 PE=2 SV=2
15	Q70JA7	0.001	43.1	882	0.132	0.057	CHSS3_HUMAN Chondroitin sulfate synthase 3 OS=Homo sapiens OX=9606 GN=CHSY3 PE=2 SV=3
16	Q86X52	0.001	43.5	802	0.153	0.072	CHSS1_HUMAN Chondroitin sulfate synthase 1 OS=Homo sapiens OX=9606 GN=CHSY1 PE=1 SV=3
17	Q9VQH6	0.001	42.7	385	0.124	0.122	Q9VQH6_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2975 PE=4 SV=1
18	Q5DTK1	0.002	43.1	884	0.132	0.057	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3
19	Q6P296	0.004	41.6	801	0.135	0.064	Q6P296_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=chys1 PE=2 SV=1
20	O23072	0.042	38.5	785	0.066	0.032	O23072_ARATH AT4g00300 protein OS=Arabidopsis thaliana OX=3702 GN=A_IG005I10.16 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02434 Fringe	2e-118	405.9	Fringe-like
2	PF13076 Fur_reg_FbpA	2.3e+02	12.9	Fur-regulated basic protein A
3	PF01762 Galactosyl_T	71	14.7	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222725

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.983	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000256646	0.975	Neurogenic locus notch homolog protein 2
3	9606.ENSP00000263388	0.966	Neurogenic locus notch homolog protein 3
4	9606.ENSP00000364163	0.942	Neurogenic locus notch homolog protein 4
5	9606.ENSP00000254958	0.815	Protein jagged-1
6	9606.ENSP00000349490	0.814	Beta-1,3-N-acetylglucosaminyltransferase manic fringe
7	9606.ENSP00000307971	0.811	Beta-1,3-N-acetylglucosaminyltransferase radical fringe
8	9606.ENSP00000446205	0.794	Transcription factor HES-7
9	9606.ENSP00000355718	0.790	Delta-like protein 1
10	9606.ENSP00000342392	0.772	Mesoderm posterior protein 2
11	9606.ENSP00000328169	0.753	Protein jagged-2
12	9606.ENSP00000205143	0.726	Delta-like protein 3
13	9606.ENSP00000314480	0.690	Homeobox protein unc-4 homolog
14	9606.ENSP00000364902	0.677	GDP-fucose protein O-fucosyltransferase 1
15	9606.ENSP00000341219	0.642	Cat eye syndrome critical region protein 2
16	9606.ENSP00000349041	0.621	Notch-regulated ankyrin repeat-containing protein
17	9606.ENSP00000367714	0.619	Transcription factor HES-5
18	9606.ENSP00000249749	0.618	Delta-like protein 4
19	9606.ENSP00000300057	0.609	Mesoderm posterior protein 1
20	9606.ENSP00000378650	0.603	T-box transcription factor TBX6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008375	0.999	acetylglucosaminyltransferase activity
GO:0033829	0.981	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity
GO:0005515	0.393	protein binding
GO:0008378	0.323	galactosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.937	regulation of cellular process
GO:0050793	0.890	regulation of developmental process
GO:0009987	0.794	cellular process
GO:0051239	0.782	regulation of multicellular organismal process
GO:0032502	0.742	developmental process
GO:0048856	0.732	anatomical structure development
GO:0032501	0.709	multicellular organismal process
GO:0022603	0.534	regulation of anatomical structure morphogenesis
GO:0007275	0.519	multicellular organism development
GO:0048518	0.467	positive regulation of biological process
GO:0050896	0.393	response to stimulus
GO:0048519	0.375	negative regulation of biological process
GO:0048522	0.347	positive regulation of cellular process
GO:0048523	0.346	negative regulation of cellular process
GO:0048731	0.338	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098588	0.998	bounding membrane of organelle
GO:0005794	0.998	Golgi apparatus
GO:0000139	0.991	Golgi membrane
GO:0005576	0.965	extracellular region
GO:0043230	0.591	extracellular organelle
GO:1903561	0.583	extracellular vesicle
GO:0070062	0.326	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	0.999	Hexosyltransferases.
EC:2.4.1.222	0.981	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase.

[back to server]