StarFunc result for job id Q8NES8

User Input

>input (71 residues)
MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYAL
KPPPVPKHEYE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NES8	1.000	1.000	1.909E-13	71	1.000	1.000	Q8NES8.pdb.gz	DB124_HUMAN Beta-defensin 124 OS=Homo sapiens OX=9606 GN=DEFB124 PE=1 SV=2
2	AFDB:Q5J5C9	0.548	0.516	3.192E-5	76	0.310	0.289	Q5J5C9.pdb.gz	DB121_HUMAN Beta-defensin 121 OS=Homo sapiens OX=9606 GN=DEFB121 PE=1 SV=1
3	AFDB:Q8N690	0.535	0.457	3.656E-5	84	0.282	0.238	Q8N690.pdb.gz	DB119_HUMAN Beta-defensin 119 OS=Homo sapiens OX=9606 GN=DEFB119 PE=2 SV=2
4	AFDB:Q96PH6	0.501	0.301	5.494E-5	123	0.296	0.171	Q96PH6.pdb.gz	DB118_HUMAN Defensin beta 118 OS=Homo sapiens OX=9606 GN=DEFB118 PE=1 SV=1
5	AFDB:Q95LI0	0.479	0.287	8.835E-5	123	0.282	0.163	Q95LI0.pdb.gz	DB118_MACMU Defensin beta 118 OS=Macaca mulatta OX=9544 GN=DEFB118 PE=2 SV=1
6	AFDB:Q7Z7B7	0.549	0.429	2.801E-4	95	0.338	0.253	Q7Z7B7.pdb.gz	DB132_HUMAN Beta-defensin 132 OS=Homo sapiens OX=9606 GN=DEFB132 PE=1 SV=1
7	AFDB:Q30KQ5	0.499	0.410	3.433E-4	88	0.268	0.216	Q30KQ5.pdb.gz	DB115_HUMAN Beta-defensin 115 OS=Homo sapiens OX=9606 GN=DEFB115 PE=1 SV=1
8	AFDB:Q8NET1	0.454	0.442	6.324E-4	73	0.225	0.219	Q8NET1.pdb.gz	D108B_HUMAN Beta-defensin 108B OS=Homo sapiens OX=9606 GN=DEFB108B PE=1 SV=3
9	AFDB:Q8WTQ1	0.463	0.456	6.768E-4	72	0.310	0.306	Q8WTQ1.pdb.gz	D104A_HUMAN Beta-defensin 104 OS=Homo sapiens OX=9606 GN=DEFB104A PE=1 SV=2
10	AFDB:Q9H1M4	0.487	0.355	8.296E-4	99	0.296	0.212	Q9H1M4.pdb.gz	DB127_HUMAN Beta-defensin 127 OS=Homo sapiens OX=9606 GN=DEFB127 PE=1 SV=1
11	PDB:2lwlA	0.342	0.513	5.360E-1	45	0.127	0.200	2lwlA.pdb.gz
12	PDB:6cs9A	0.346	0.554	6.139E-1	41	0.099	0.171	6cs9A.pdb.gz	Human beta-defensin 2 killsCandida albicansthrough phosphatidylinositol 4,5-bisphosphate-mediated membrane permeabilization.
13	PDB:1e4rA	0.313	0.526	2.083	35	0.113	0.229	1e4rA.pdb.gz
14	PDB:1bnbA	0.339	0.545	2.553	38	0.113	0.211	1bnbA.pdb.gz
15	PDB:5lcsA	0.343	0.481	2.553	47	0.113	0.170	5lcsA.pdb.gz
16	PDB:6h25I	0.246	0.321	2.732	50	0.070	0.100	6h25I.pdb.gz	Distinct and evolutionary conserved structural features of the human nuclear exosome complex.
17	PDB:7ac7A	0.152	0.132	3.584	84	0.070	0.060	7ac7A.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
18	PDB:6ta5D	0.123	0.048	4.702	345	0.127	0.026	6ta5D.pdb.gz
19	PDB:1kj6A	0.284	0.411	5.032	45	0.099	0.156	1kj6A.pdb.gz
20	PDB:4lecA	0.133	0.058	6.169	202	0.070	0.025	4lecA.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NES8	2.60e-48	148	71	1.000	1.000	DB124_HUMAN Beta-defensin 124 OS=Homo sapiens OX=9606 GN=DEFB124 PE=1 SV=2
2	Q9H1M4	9.17e-05	39.3	99	0.296	0.212	DB127_HUMAN Beta-defensin 127 OS=Homo sapiens OX=9606 GN=DEFB127 PE=1 SV=1
3	Q6IV18	9.00e-04	36.2	89	0.310	0.247	GLL13_CHICK Gallinacin-13 OS=Gallus gallus OX=9031 GN=GAL13 PE=2 SV=1
4	Q7Z7B7	0.002	35.4	95	0.324	0.242	DB132_HUMAN Beta-defensin 132 OS=Homo sapiens OX=9606 GN=DEFB132 PE=1 SV=1
5	Q8NET1	0.014	33.1	73	0.225	0.219	D108B_HUMAN Beta-defensin 108B OS=Homo sapiens OX=9606 GN=DEFB108B PE=1 SV=3
6	Q5J5C9	0.055	31.6	76	0.169	0.158	DB121_HUMAN Beta-defensin 121 OS=Homo sapiens OX=9606 GN=DEFB121 PE=1 SV=1
7	Q8BVC1	0.31	30.4	179	0.268	0.106	DFB22_MOUSE Beta-defensin 22 OS=Mus musculus OX=10090 GN=Defb22 PE=1 SV=1
8	Q387A9	0.45	30.0	752	0.183	0.017	Q387A9_TRYB2 DM10 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.47.0006 PE=4 SV=1
9	Q9BYW3	0.67	29.3	111	0.225	0.144	DB126_HUMAN Beta-defensin 126 OS=Homo sapiens OX=9606 GN=DEFB126 PE=1 SV=2
10	J9VPD7	1.3	28.9	470	0.211	0.032	CDA1_CRYNH Chitin deacetylase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CDA1 PE=1 SV=1
11	Q96PH6	1.5	28.5	123	0.141	0.081	DB118_HUMAN Defensin beta 118 OS=Homo sapiens OX=9606 GN=DEFB118 PE=1 SV=1
12	Q38AQ2	1.9	28.5	528	0.310	0.042	Q38AQ2_TRYB2 inositol-3-phosphate synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3600 PE=3 SV=1
13	Q95LI0	2.0	28.1	123	0.141	0.081	DB118_MACMU Defensin beta 118 OS=Macaca mulatta OX=9544 GN=DEFB118 PE=2 SV=1
14	Q9SU93	3.2	27.7	306	0.169	0.039	Q9SU93_ARATH Nucleophosmin OS=Arabidopsis thaliana OX=3702 GN=SES1 PE=1 SV=1
15	Q9Y7U7	3.7	27.7	878	0.169	0.014	SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snd1 PE=1 SV=1
16	Q30KQ5	3.9	26.9	88	0.141	0.114	DB115_HUMAN Beta-defensin 115 OS=Homo sapiens OX=9606 GN=DEFB115 PE=1 SV=1
17	Q8N690	4.0	26.9	84	0.211	0.179	DB119_HUMAN Beta-defensin 119 OS=Homo sapiens OX=9606 GN=DEFB119 PE=2 SV=2
18	Q8WTQ1	4.3	26.6	72	0.211	0.208	D104A_HUMAN Beta-defensin 104 OS=Homo sapiens OX=9606 GN=DEFB104A PE=1 SV=2
19	Q92681	4.5	27.3	617	0.183	0.021	RSCA1_HUMAN Regulatory solute carrier protein family 1 member 1 OS=Homo sapiens OX=9606 GN=RSC1A1 PE=1 SV=1
20	Q23088	4.9	27.3	594	0.211	0.025	UVSSA_CAEEL UV-stimulated scaffold protein A homolog OS=Caenorhabditis elegans OX=6239 GN=uvs-1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13841 Defensin_beta_2	0.00033	32.3	Beta defensin
2	PF13966 zf-RVT	1.1e+02	14.9	zinc-binding in reverse transcriptase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326309

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335382	0.981	Beta-defensin 128
2	9606.ENSP00000371847	0.981	Beta-defensin 125
3	9606.ENSP00000365492	0.977	Defensin beta 119
4	9606.ENSP00000371643	0.977	Beta-defensin 135
5	9606.ENSP00000371825	0.977	Beta-defensin 127
6	9606.ENSP00000371835	0.973	Beta-defensin 126
7	9606.ENSP00000381703	0.971	Beta-defensin 113
8	9606.ENSP00000360190	0.962	Beta-defensin 110
9	9606.ENSP00000383396	0.962	Beta-defensin 116
10	9606.ENSP00000383398	0.962	Beta-defensin 115
11	9606.ENSP00000435010	0.962	Beta-defensin 134
12	9606.ENSP00000246105	0.959	Beta-defensin 129
13	9606.ENSP00000417128	0.954	Beta-defensin 121
14	9606.ENSP00000312702	0.953	Beta-defensin 114
15	9606.ENSP00000365486	0.953	Beta-defensin 123
16	9606.ENSP00000253381	0.945	Beta-defensin 118
17	9606.ENSP00000335538	0.941	Beta-defensin 131A
18	9606.ENSP00000328359	0.932	Neutrophil defensin 3
19	9606.ENSP00000329890	0.929	Defensin-5
20	9606.ENSP00000371644	0.926	Beta-defensin 136

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044419	0.991	biological process involved in interspecies interaction between organisms
GO:0009607	0.991	response to biotic stimulus
GO:0009987	0.987	cellular process
GO:0009617	0.979	response to bacterium
GO:0001817	0.972	regulation of cytokine production
GO:0051716	0.953	cellular response to stimulus
GO:0050794	0.953	regulation of cellular process
GO:0048518	0.952	positive regulation of biological process
GO:0042221	0.937	response to chemical
GO:0040012	0.932	regulation of locomotion
GO:0032101	0.909	regulation of response to external stimulus
GO:0002687	0.890	positive regulation of leukocyte migration
GO:0050920	0.882	regulation of chemotaxis
GO:0002688	0.860	regulation of leukocyte chemotaxis
GO:0032642	0.858	regulation of chemokine production
GO:0071675	0.858	regulation of mononuclear cell migration
GO:0023052	0.838	signaling
GO:0006950	0.831	response to stress
GO:0098542	0.817	defense response to other organism
GO:0007154	0.806	cell communication
GO:0010033	0.783	response to organic substance
GO:0042742	0.724	defense response to bacterium
GO:0002376	0.720	immune system process
GO:0006955	0.684	immune response
GO:0010628	0.582	positive regulation of gene expression
GO:0050829	0.558	defense response to Gram-negative bacterium
GO:0045087	0.552	innate immune response
GO:0001819	0.535	positive regulation of cytokine production
GO:0032655	0.528	regulation of interleukin-12 production
GO:0032675	0.527	regulation of interleukin-6 production
GO:0070887	0.525	cellular response to chemical stimulus
GO:0032103	0.509	positive regulation of response to external stimulus
GO:0002690	0.419	positive regulation of leukocyte chemotaxis
GO:0032722	0.414	positive regulation of chemokine production
GO:0071677	0.413	positive regulation of mononuclear cell migration
GO:0071216	0.409	cellular response to biotic stimulus
GO:0007165	0.402	signal transduction
GO:1901700	0.377	response to oxygen-containing compound
GO:1901701	0.364	cellular response to oxygen-containing compound
GO:1901698	0.344	response to nitrogen compound
GO:0050830	0.341	defense response to Gram-positive bacterium
GO:0071310	0.332	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0005622	0.990	intracellular anatomical structure
GO:0043227	0.989	membrane-bounded organelle
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0005615	0.981	extracellular space
GO:0005737	0.924	cytoplasm
GO:0012505	0.748	endomembrane system
GO:0005794	0.686	Golgi apparatus
GO:0031982	0.659	vesicle
GO:0030141	0.501	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]