StarFunc result for job id Q8NET4

User Input

>input (1388 residues)
MSIPLHSLRFNNTMREENVEPQNKQMAFCRPMTETRADVQILHSHVQLPIVSTSASDPGG
TSTQLMTSPVFDTMSAPLMGVPNSGALSPPLMPASDSGALSPLLMPASDSGALSPLLMPA
LDSGTLSPLLSTSEYGVMSPGMMTIPDFGTMSATLMVAPDSAEISPLAMPAPSSGVVCTP
IMSTSSSEAMSTPLMLAPDSGELSPILMQDMNPGVMSTQPVPAPSSEAMSPLQITDEDTE
AMSKVLMTALASGEISSLLMSGTDSEAISSLIMSAVASGGTSPQPTSTQNSGGIPTPLMS
DLDSGIMSSLLMSSPGSEVMSTPLLSVPDAGEMSTLPKPAPDAEAMSPALMTALPSGVMP
TQTMPAPGSGAMSPWSTQNVDSEMMSNPPVRATASGVMSAPPVRALDSGAMSTPLMGAPA
SGNMSTLQKTVPASGAMTTSLMTVPSSGVMSTEQMSATASRVMSAQLTMAKTSGAMPTGS
MKAVAKQYKRATASGKMSTPLRRAPTSGAMSTQPVTATASETMSMPQLTVPASGSMSMLQ
MRAPVSEAMSMPQMRTMASGLTSAAQMKAMTSGAMSTPLMTAQTSGSTSTLLMRDTASGV
MSCPQMRSLASGALSKPLMTPKASGTMFTEKMTTTASEAMPTLLMRDTVSGALSMPQMTD
TASGGLSASLMRDTASGAMSTSQMTATVSGGMSMPLMRAQDPGVMPASLMRAKVSGKMLS
QPMSTQDPGGMSMSPMKSMTAGGMQMNSPTSDVMSTPTVRAWTSETMSTPLMRTSDPGER
PSLLTRASSSGEMSLPLMRAPASGEIATPLRSPAYGAMSAPQMTATASGMMSSMPQVKAP
ISGAMSMPLTRSTASGGMSMPLMRAPDSRVTSTSQMMPTASGDMCTLPVRAPASGGVSSP
LVRAPASGTMSTPLRRPSACETVSTELMRASASGHMSTAQTTAMVSGGMSKPLMRAPASG
TMPMPLMSAMASGEMSMPLMETMASGATSTLQTSVANSRSMSLSQTTYTVSGRMATAPIR
ASASGARSTSFMRASVSGSMPMPLPRATASGCGMGMSMPQMTATDSRGMSTPLMRASGPG
TMSTPQTAFGVMSTPEIKATDSGEASTSHINITASGSKPTSHMTATTPETAKPPPKEVPS
FGMLTPALCYLLEEQEAARGSCSVEEEMEIDEEKQMKGFLDDSERMAFLVSLHLGAAERW
FILQMEVGEPLSHENKSFLRRSQGIYDSLSEIDILSAVLCHPKQGQKSVRQYATDFLLLA
RHLSWSDAILRTRFLEGLSEAVTTKMGRIFLKVAGSLKELIDRSLYTECQLAEEKDSPGN
SSQVLPTACKRNNEEAMGNELSSQQQTEEHQHVSKRCYYLKEHGDPQEGLHDHLGQSTGH
HQKAHTNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88573	0.050	0.054	7.272E-3	1216	0.135	0.154	O88573.pdb.gz	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
2	AFDB:Q8NEY1	0.033	0.031	1.026E-2	1877	0.166	0.123	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
3	AFDB:P00522	0.052	0.046	3.630E-2	1620	0.120	0.102	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
4	AFDB:Q9H0B3	0.042	0.047	3.845E-2	1180	0.143	0.168	Q9H0B3.pdb.gz	IQCN_HUMAN IQ domain-containing protein N OS=Homo sapiens OX=9606 GN=IQCN PE=1 SV=1
5	AFDB:O77086	0.046	0.044	4.072E-2	1571	0.150	0.132	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
6	AFDB:A0A0B4K7S6	0.037	0.031	4.568E-2	1965	0.135	0.096	A0A0B4K7S6.pdb.gz	A0A0B4K7S6_DROME Molting defective, isoform D OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
7	AFDB:Q69ZZ9	0.031	0.037	5.123E-2	979	0.105	0.149	Q69ZZ9.pdb.gz	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
8	AFDB:Q0KHR2	0.035	0.034	6.446E-2	1918	0.140	0.101	Q0KHR2.pdb.gz	Q0KHR2_DROME Forked, isoform F OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
9	AFDB:F4IZK5	0.053	0.052	6.827E-2	1403	0.130	0.129	F4IZK5.pdb.gz	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
10	AFDB:Q9Z1Q1	0.041	0.033	6.827E-2	1818	0.138	0.106	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
11	PDB:7r24A	0.070	0.362	6.990E-2	150	0.014	0.133	7r24A.pdb.gz
12	PDB:6vvoE	0.054	0.156	1.645	346	0.011	0.043	6vvoE.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
13	PDB:7k1kA	0.035	0.019	1.645	3604	0.019	0.007	7k1kA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
14	PDB:6w1sR	0.044	0.047	1.954	1295	0.015	0.016	6w1sR.pdb.gz	A Pliable Mediator Acts as a Functional Rather Than an Architectural Bridge between Promoters and Enhancers.
15	PDB:7z6hD	0.047	0.136	2.069	324	0.016	0.068	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
16	PDB:6w6l4	0.035	0.158	2.603	221	0.012	0.077	6w6l4.pdb.gz	An ER translocon for multi-pass membrane protein biogenesis.
17	PDB:6z3mP	0.029	0.266	2.603	76	0.010	0.184	6z3mP.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
18	PDB:7puaFX	0.048	0.195	2.603	220	0.009	0.059	7puaFX.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
19	PDB:5jxdA	0.033	0.142	2.757	186	0.017	0.129	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
20	PDB:2v6kA	0.032	0.149	3.093	214	0.009	0.056	2v6kA.pdb.gz	Structure of Bacterial Glutathione-S-Transferase Maleyl Pyruvate Isomerase and Implications for Mechanism of Isomerisation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O96124	7.96e-17	89.4	2441	0.133	0.076	O96124_PLAF7 Erythrocyte membrane protein 3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201900 PE=4 SV=1
2	A0A087WZG9	5.74e-09	62.0	359	0.027	0.103	A0A087WZG9_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
3	A0A087WX23	8.56e-09	62.8	783	0.027	0.049	A0A087WX23_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=1
4	A0A087WUL4	1.51e-08	61.6	741	0.027	0.051	A0A087WUL4_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
5	Q86TG7	2.18e-08	61.2	708	0.027	0.052	PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
6	A0A087WXK2	2.33e-08	61.2	707	0.027	0.052	A0A087WXK2_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=1
7	M9PC41	2.65e-08	61.6	22743	0.132	0.008	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PEI1	3.37e-08	61.2	21657	0.132	0.008	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PC45	3.58e-08	61.2	22300	0.132	0.008	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PBZ0	3.64e-08	61.2	22830	0.132	0.008	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PB30	3.73e-08	61.2	22949	0.132	0.008	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
12	Q7TN75	1.17e-05	52.4	958	0.024	0.035	PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus OX=10090 GN=Peg10 PE=1 SV=2
13	Q7M732	0.027	41.6	1744	0.023	0.018	RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus OX=10090 GN=Rtl1 PE=2 SV=1
14	B7YZG4	0.043	41.2	5368	0.043	0.011	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	A0A0B4K7P8	0.049	40.8	5394	0.043	0.011	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	A0A0B4K7Y9	0.049	40.8	5408	0.043	0.011	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	E1JH62	0.050	40.8	5388	0.043	0.011	E1JH62_DROME Short stop, isoform N OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	G8BJ59	0.054	40.4	1153	0.022	0.026	G8BJ59_CANPC Agglutinin-like protein N-terminal domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=ALS11 PE=3 SV=1
19	E1JH63	0.057	40.4	5499	0.043	0.011	E1JH63_DROME Short stop, isoform O OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	B7YZG6	0.058	40.4	5479	0.043	0.011	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03732 Retrotrans_gag	1.8	20.2	Retrotransposon gag protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419786

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340434	0.841	Retrotransposon Gag-like protein 6
2	9606.ENSP00000318131	0.800	Paraneoplastic antigen-like protein 8A
3	9606.ENSP00000484056	0.743	Zinc finger CCHC-type containing 3
4	9606.ENSP00000257013	0.716	Retrotransposon Gag-like protein 8B
5	9606.ENSP00000340590	0.714	Retrotransposon Gag-like protein 4
6	9606.ENSP00000361143	0.699	Transmembrane protein 164
7	9606.ENSP00000262844	0.689	AMME syndrome candidate gene 1 protein
8	9606.ENSP00000264360	0.668	Protocadherin-10
9	9606.ENSP00000359557	0.650	Protein LDOC1
10	9606.ENSP00000261336	0.649	Pregnancy zone protein
11	9606.ENSP00000429344	0.642	Paraneoplastic Ma antigens
12	9606.ENSP00000377699	0.638	Adhesion G-protein coupled receptor G4
13	9606.ENSP00000450565	0.634	Interleukin-11 receptor subunit alpha
14	9606.ENSP00000274140	0.632	E3 ubiquitin-protein ligase MARCH6
15	9606.ENSP00000361397	0.603	NUT family member 2G
16	9606.ENSP00000218006	0.575	Retinal guanylyl cyclase 2
17	9606.ENSP00000308921	0.569	Zinc finger CCHC domain-containing protein 12
18	9606.ENSP00000469332	0.558	Gamma-aminobutyric acid receptor subunit theta
19	9606.ENSP00000218004	0.554	NTF2-related export protein 2
20	9606.ENSP00000375268	0.550	Retrotransposon Gag-like protein 8B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.648	organic cyclic compound binding
GO:1901363	0.644	heterocyclic compound binding
GO:0003676	0.578	nucleic acid binding
GO:0003824	0.458	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0009987	0.956	cellular process
GO:0050794	0.956	regulation of cellular process
GO:0048519	0.693	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.971	intracellular organelle
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0031974	0.956	membrane-enclosed lumen
GO:0005634	0.954	nucleus
GO:0070013	0.952	intracellular organelle lumen
GO:0031981	0.901	nuclear lumen
GO:0005654	0.866	nucleoplasm
GO:0005737	0.716	cytoplasm
GO:0005576	0.634	extracellular region
GO:0005886	0.467	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]