StarFunc result for job id Q8NET5

User Input

>input (270 residues)
MENQPVRWRALPGLPRPPGLPAAPWLLLGVLLLPGTLRLAGGQSVTHTGLPIMASLANTA
ISFSCRITYPYTPQFKVFTVSYFHEDLQGQRSPKKPTNCHPGLGTENQSHTLDCQVTLVL
PGASATGTYYCSVHWPHSTVRGSGTFILVRDAGYREPPQSPQKLLLFGFTGLLSVLSVVG
TALLLWNKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGS
SPTAKQSPLSQERPHRFEDDGELNLVYENL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NET5	1.000	1.000	8.199E-48	270	1.000	1.000	Q8NET5.pdb.gz	NFAM1_HUMAN NFAT activation molecule 1 OS=Homo sapiens OX=9606 GN=NFAM1 PE=1 SV=1
2	AFDB:Q8R4V1	0.520	0.530	1.771E-23	264	0.474	0.485	Q8R4V1.pdb.gz	NFAM1_MOUSE NFAT activation molecule 1 OS=Mus musculus OX=10090 GN=Nfam1 PE=1 SV=1
3	AFDB:D3ZIN8	0.283	0.268	2.327E-9	287	0.163	0.153	D3ZIN8.pdb.gz	D3ZIN8_RAT Programmed cell death 1 OS=Rattus norvegicus OX=10116 GN=Pdcd1 PE=4 SV=1
4	AFDB:O95297	0.271	0.272	6.904E-9	269	0.148	0.149	O95297.pdb.gz	MPZL1_HUMAN Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1
5	AFDB:Q96BF3	0.284	0.277	1.453E-8	282	0.174	0.167	Q96BF3.pdb.gz	TMIG2_HUMAN Transmembrane and immunoglobulin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMIGD2 PE=1 SV=2
6	AFDB:E7F7T2	0.274	0.280	1.629E-8	264	0.152	0.155	E7F7T2.pdb.gz	E7F7T2_DANRE Myelin protein zero-like 1 like OS=Danio rerio OX=7955 GN=zgc:110608 PE=1 SV=1
7	AFDB:Q3TB92	0.299	0.320	2.297E-8	246	0.152	0.167	Q3TB92.pdb.gz	MILR1_MOUSE Allergin-1 OS=Mus musculus OX=10090 GN=Milr1 PE=1 SV=2
8	AFDB:Q7Z6A9	0.289	0.273	4.564E-8	289	0.144	0.135	Q7Z6A9.pdb.gz	BTLA_HUMAN B- and T-lymphocyte attenuator OS=Homo sapiens OX=9606 GN=BTLA PE=1 SV=3
9	AFDB:Q96PJ5	0.246	0.139	7.215E-8	515	0.163	0.085	Q96PJ5.pdb.gz	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
10	AFDB:Q9W335	0.265	0.243	8.090E-8	302	0.148	0.132	Q9W335.pdb.gz	Q9W335_DROME Translocon-associated protein subunit alpha OS=Drosophila melanogaster OX=7227 GN=l(1)G0320 PE=1 SV=1
11	PDB:8e4cC	0.245	0.421	1.621E-6	142	0.100	0.190	8e4cC.pdb.gz
12	PDB:1k4dB	0.265	0.328	6.778E-6	212	0.085	0.108	1k4dB.pdb.gz
13	PDB:1aifA	0.274	0.335	7.177E-6	215	0.085	0.107	1aifA.pdb.gz
14	PDB:5ir3A	0.280	0.614	8.521E-6	111	0.059	0.144	5ir3A.pdb.gz
15	PDB:1ezvX	0.279	0.538	1.347E-5	127	0.063	0.134	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
16	PDB:4m62L	0.268	0.576	1.510E-5	113	0.056	0.133	4m62L.pdb.gz
17	PDB:2cd0A	0.286	0.633	1.599E-5	111	0.056	0.135	2cd0A.pdb.gz
18	PDB:1jv5A	0.279	0.646	2.011E-5	107	0.059	0.150	1jv5A.pdb.gz
19	PDB:1cicA	0.269	0.331	2.387E-5	214	0.089	0.112	1cicA.pdb.gz
20	PDB:1jnhA	0.276	0.349	2.387E-5	208	0.070	0.091	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NET5	0.0	554	270	1.000	1.000	NFAM1_HUMAN NFAT activation molecule 1 OS=Homo sapiens OX=9606 GN=NFAM1 PE=1 SV=1
2	Q8R4V1	1.11e-70	220	264	0.467	0.477	NFAM1_MOUSE NFAT activation molecule 1 OS=Mus musculus OX=10090 GN=Nfam1 PE=1 SV=1
3	F4JCR3	0.96	33.5	1607	0.067	0.011	F4JCR3_ARATH Ubiquitin carboxyl-terminal hydrolase-related protein OS=Arabidopsis thaliana OX=3702 GN=At3g47910 PE=1 SV=1
4	Q91ZT1	2.0	32.3	1363	0.133	0.026	VGFR3_RAT Vascular endothelial growth factor receptor 3 OS=Rattus norvegicus OX=10116 GN=Flt4 PE=1 SV=1
5	Q7Z7B0	2.1	32.3	1213	0.074	0.016	FLIP1_HUMAN Filamin-A-interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1 PE=1 SV=1
6	A0A075B6G6	2.2	32.3	1114	0.074	0.018	A0A075B6G6_HUMAN Filamin A interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1 PE=1 SV=1
7	Q8BHB3	2.7	31.6	407	0.074	0.049	LAX1_MOUSE Lymphocyte transmembrane adapter 1 OS=Mus musculus OX=10090 GN=Lax1 PE=2 SV=2
8	Q5E6B4	3.4	31.6	476	0.104	0.059	Q5E6B4_ALIF1 Autoinducer repressor protein LuxO OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=luxO PE=4 SV=1
9	Q8MRA3	3.9	31.6	1228	0.181	0.040	Q8MRA3_DROME Hibris, isoform A OS=Drosophila melanogaster OX=7227 GN=hbs PE=2 SV=1
10	Q9CS72	4.2	31.6	1214	0.070	0.016	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
11	Q8K4T4	4.4	31.2	1212	0.070	0.016	FLIP1_RAT Filamin-A-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Filip1 PE=1 SV=1
12	Q8IZF4	5.0	31.2	528	0.056	0.028	AGRG5_HUMAN Adhesion G-protein coupled receptor G5 OS=Homo sapiens OX=9606 GN=ADGRG5 PE=1 SV=3
13	Q8IWV1	6.6	30.4	398	0.048	0.033	LAX1_HUMAN Lymphocyte transmembrane adapter 1 OS=Homo sapiens OX=9606 GN=LAX1 PE=1 SV=1
14	P9WLT5	8.8	29.6	193	0.056	0.078	Y1591_MYCTU Uncharacterized protein Rv1591 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1591 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10821 DUF2567	4.9e+02	12.2	Protein of unknown function (DUF2567)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333680

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364907	0.682	Tyrosine-protein kinase SYK
2	9606.ENSP00000264972	0.660	Tyrosine-protein kinase ZAP-70
3	9606.ENSP00000225726	0.504	Involved in the regulation of calcium ion homeostasis in the endoplasmic reticulum . Required for proper protein degradation via the ERAD pathway . Has an essential role in the maintenance of endoplasmic reticulum organization during embryogenesis (By similarity)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	1.000	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.996	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0051716	0.986	cellular response to stimulus
GO:0019222	0.980	regulation of metabolic process
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0065009	0.957	regulation of molecular function
GO:0007165	0.952	signal transduction
GO:0080090	0.855	regulation of primary metabolic process
GO:0010468	0.807	regulation of gene expression
GO:0051171	0.802	regulation of nitrogen compound metabolic process
GO:0031323	0.799	regulation of cellular metabolic process
GO:0010556	0.582	regulation of macromolecule biosynthetic process
GO:0031326	0.582	regulation of cellular biosynthetic process
GO:0048518	0.552	positive regulation of biological process
GO:0006355	0.509	regulation of DNA-templated transcription
GO:0044093	0.507	positive regulation of molecular function
GO:0051090	0.470	regulation of DNA-binding transcription factor activity
GO:0035556	0.380	intracellular signal transduction
GO:0048583	0.358	regulation of response to stimulus
GO:0048522	0.342	positive regulation of cellular process
GO:0002376	0.335	immune system process
GO:0002682	0.309	regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.998	endomembrane system
GO:0031410	0.997	cytoplasmic vesicle
GO:0098588	0.990	bounding membrane of organelle
GO:0012506	0.956	vesicle membrane
GO:0030141	0.946	secretory granule
GO:0030659	0.946	cytoplasmic vesicle membrane
GO:0000323	0.925	lytic vacuole
GO:0005764	0.923	lysosome
GO:0005774	0.884	vacuolar membrane
GO:0030667	0.868	secretory granule membrane
GO:0098852	0.850	lytic vacuole membrane
GO:0005765	0.841	lysosomal membrane
GO:0005766	0.774	primary lysosome
GO:0005829	0.731	cytosol
GO:0042582	0.670	azurophil granule
GO:0035577	0.637	azurophil granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]