StarFunc result for job id Q8NET8

User Input

>input (790 residues)
MKAHPKEMVPLMGKRVAAPSGNPAILPEKRPAEITPTKKSAHFFLEIEGFEPNPTVAKTS
PPVFSKPMDSNIRQCISGNCDDMDSPQSPQDDVTETPSNPNSPSAQLAKEEQRRKKRRLK
KRIFAAVSEGCVEELVELLVELQELCRRRHDEDVPDFLMHKLTASDTGKTCLMKALLNIN
PNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTALNIAIERRQGDIAALLIAAGAD
VNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNIL
HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYI
LSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEML
TLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMG
WLQLLGRMFVLIWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLY
LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLG
FGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLIT
YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL
CKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFE
EVEEFPETSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PU00	0.879	0.878	1.332E-98	791	0.932	0.930	E9PU00.pdb.gz	E9PU00_RAT Transient receptor potential cation channel, subfamily V, member 3 OS=Rattus norvegicus OX=10116 GN=Trpv3 PE=4 SV=1
2	PDB:6mhvA	0.757	0.971	1.111E-73	613	0.773	0.997	6mhvA.pdb.gz
3	PDB:6pvpA	0.775	0.922	3.606E-68	661	0.794	0.949	6pvpA.pdb.gz
4	PDB:6uw9A	0.699	0.941	9.440E-60	582	0.732	0.993	6uw9A.pdb.gz
5	PDB:6pvqA	0.659	0.919	6.986E-56	562	0.667	0.938	6pvqA.pdb.gz
6	AFDB:Q8NER1	0.737	0.695	1.444E-51	839	0.399	0.375	Q8NER1.pdb.gz	TRPV1_HUMAN Transient receptor potential cation channel subfamily V member 1 OS=Homo sapiens OX=9606 GN=TRPV1 PE=1 SV=2
7	AFDB:B2KN54	0.764	0.697	4.668E-51	871	0.392	0.356	B2KN54.pdb.gz	B2KN54_CANLF TRPV4 OS=Canis lupus familiaris OX=9615 GN=LOC100856786 PE=2 SV=1
8	AFDB:A2BG42	0.751	0.695	9.773E-51	856	0.395	0.364	A2BG42.pdb.gz
9	AFDB:A0A6I8RQZ3	0.747	0.683	1.512E-48	868	0.376	0.342	A0A6I8RQZ3.pdb.gz	A0A6I8RQZ3_XENTR Transient receptor potential cation channel subfamily V member 4 OS=Xenopus tropicalis OX=8364 GN=trpv4 PE=1 SV=1
10	PDB:7lp9A	0.750	0.928	2.824E-47	634	0.376	0.468	7lp9A.pdb.gz	Heat-dependent opening of TRPV1 in the presence of capsaicin.
11	AFDB:A0A1J0M1I2	0.743	0.718	6.348E-47	819	0.366	0.353	A0A1J0M1I2.pdb.gz
12	AFDB:Q9WUD2	0.743	0.769	2.789E-43	761	0.375	0.389	Q9WUD2.pdb.gz	TRPV2_RAT Transient receptor potential cation channel subfamily V member 2 OS=Rattus norvegicus OX=10116 GN=Trpv2 PE=1 SV=2
13	AFDB:G1SNM3	0.737	0.715	3.177E-43	817	0.371	0.359	G1SNM3.pdb.gz	G1SNM3_RABIT Transient receptor potential cation channel subfamily V member 2 OS=Oryctolagus cuniculus OX=9986 GN=TRPV2 PE=1 SV=2
14	AFDB:F1RIT1	0.685	0.659	3.465E-43	824	0.361	0.346	F1RIT1.pdb.gz	F1RIT1_PIG Transient receptor potential cation channel subfamily V member 4 OS=Sus scrofa OX=9823 GN=TRPV4 PE=4 SV=4
15	AFDB:Q5EA32	0.713	0.745	6.102E-42	753	0.353	0.371	Q5EA32.pdb.gz	Q5EA32_BOVIN Transient receptor potential cation channel subfamily V member 2 OS=Bos taurus OX=9913 GN=TRPV2 PE=1 SV=1
16	PDB:6u84A	0.664	0.819	1.483E-37	630	0.334	0.419	6u84A.pdb.gz
17	PDB:7aa5A	0.664	0.844	8.078E-37	612	0.356	0.459	7aa5A.pdb.gz
18	PDB:6bwjB	0.671	0.845	1.048E-36	617	0.338	0.433	6bwjB.pdb.gz	Conformational plasticity in the selectivity filter of the TRPV2 ion channel.
19	PDB:6e2fC	0.630	0.759	9.276E-27	647	0.228	0.278	6e2fC.pdb.gz	Mechanism of calmodulin inactivation of the calcium-selective TRP channel TRPV6.
20	PDB:6dmwA	0.630	0.776	1.780E-26	631	0.228	0.285	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6I8RQZ3	0.0	554	868	0.365	0.332	A0A6I8RQZ3_XENTR Transient receptor potential cation channel subfamily V member 4 OS=Xenopus tropicalis OX=8364 GN=trpv4 PE=1 SV=1
2	B2KN54	0.0	554	871	0.410	0.372	B2KN54_CANLF TRPV4 OS=Canis lupus familiaris OX=9615 GN=LOC100856786 PE=2 SV=1
3	B3VP30	0.0	555	871	0.376	0.341	B3VP30_PIG Transient receptor potential cation channel subfamily V member 4 OS=Sus scrofa OX=9823 GN=TRPV4 PE=2 SV=1
4	E9PU00	0.0	1484	791	0.933	0.932	E9PU00_RAT Transient receptor potential cation channel, subfamily V, member 3 OS=Rattus norvegicus OX=10116 GN=Trpv3 PE=4 SV=1
5	O35433	0.0	570	838	0.395	0.372	TRPV1_RAT Transient receptor potential cation channel subfamily V member 1 OS=Rattus norvegicus OX=10116 GN=Trpv1 PE=1 SV=1
6	Q0PEH1	0.0	545	841	0.371	0.348	Q0PEH1_DANRE Transient receptor potential cation channel subfamily V member 4 OS=Danio rerio OX=7955 GN=wu:fp52e02 PE=2 SV=1
7	Q2M3L1	0.0	1633	791	0.996	0.995	Q2M3L1_HUMAN TRPV3 protein OS=Homo sapiens OX=9606 GN=TRPV3 PE=1 SV=1
8	Q704Y3	0.0	569	839	0.389	0.366	TRPV1_MOUSE Transient receptor potential cation channel subfamily V member 1 OS=Mus musculus OX=10090 GN=Trpv1 PE=1 SV=1
9	Q8K424	0.0	1484	791	0.932	0.930	TRPV3_MOUSE Transient receptor potential cation channel subfamily V member 3 OS=Mus musculus OX=10090 GN=Trpv3 PE=1 SV=2
10	Q8NER1	0.0	562	839	0.378	0.356	TRPV1_HUMAN Transient receptor potential cation channel subfamily V member 1 OS=Homo sapiens OX=9606 GN=TRPV1 PE=1 SV=2
11	Q8NET8	0.0	1642	790	1.000	1.000	TRPV3_HUMAN Transient receptor potential cation channel subfamily V member 3 OS=Homo sapiens OX=9606 GN=TRPV3 PE=1 SV=2
12	Q9EPK8	0.0	552	871	0.370	0.335	TRPV4_MOUSE Transient receptor potential cation channel subfamily V member 4 OS=Mus musculus OX=10090 GN=Trpv4 PE=1 SV=1
13	Q9ERZ8	0.0	556	871	0.373	0.339	TRPV4_RAT Transient receptor potential cation channel subfamily V member 4 OS=Rattus norvegicus OX=10116 GN=Trpv4 PE=1 SV=1
14	Q9HBA0	0.0	555	871	0.411	0.373	TRPV4_HUMAN Transient receptor potential cation channel subfamily V member 4 OS=Homo sapiens OX=9606 GN=TRPV4 PE=1 SV=2
15	B0S711	6.27e-159	484	813	0.365	0.354	B0S711_DANRE Transient receptor potential cation channel subfamily V member 1 OS=Danio rerio OX=7955 GN=si:dkey-9e15.2 PE=4 SV=1
16	B6RTA2	4.75e-158	482	819	0.365	0.352	B6RTA2_DANRE Transient receptor potential cation channel subfamily V member 1 OS=Danio rerio OX=7955 GN=TRPV1 PE=2 SV=1
17	F1RIT1	9.26e-156	476	823	0.372	0.357	F1RIT1_PIG Transient receptor potential cation channel subfamily V member 4 OS=Sus scrofa OX=9823 GN=TRPV4 PE=4 SV=4
18	Q9Y5S1	1.12e-135	422	764	0.341	0.352	TRPV2_HUMAN Transient receptor potential cation channel subfamily V member 2 OS=Homo sapiens OX=9606 GN=TRPV2 PE=1 SV=1
19	Q9WTR1	4.24e-134	417	756	0.365	0.381	TRPV2_MOUSE Transient receptor potential cation channel subfamily V member 2 OS=Mus musculus OX=10090 GN=Trpv2 PE=1 SV=2
20	Q9WUD2	8.89e-133	414	761	0.386	0.401	TRPV2_RAT Transient receptor potential cation channel subfamily V member 2 OS=Rattus norvegicus OX=10116 GN=Trpv2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.5e-10	51.5	Ankyrin repeat
2	PF12796 Ank_2	5.8e-18	76.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	7.2e-11	52.2	Ankyrin repeat
4	PF13637 Ank_4	3.5e-05	35.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.2e-06	39.9	Ankyrin repeats (many copies)
6	PF16039 DUF4791	1.4e+02	13.3	Domain of unknown function (DUF4791)
7	PF00520 Ion_trans	1.3e-06	39.4	Ion transport protein
8	PF03296 Pox_polyA_pol	18	16.6	Poxvirus poly(A) polymerase nucleotidyltransferase domain
9	PF07771 TSGP1	6.7e+02	11.8	Tick salivary peptide group 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301365

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323926	0.950	Transient receptor potential cation channel subfamily M member 8
2	9606.ENSP00000299163	0.814	Hypoxia-inducible factor 1-alpha inhibitor
3	9606.ENSP00000252826	0.779	Transient receptor potential cation channel subfamily M member 4
4	9606.ENSP00000366314	0.767	Transient receptor potential cation channel subfamily M member 3
5	9606.ENSP00000262839	0.760	Short transient receptor potential channel 5
6	9606.ENSP00000368966	0.755	Short transient receptor potential channel 3
7	9606.ENSP00000419313	0.742	Short transient receptor potential channel 1
8	9606.ENSP00000340913	0.724	Short transient receptor potential channel 6
9	9606.ENSP00000275493	0.722	Epidermal growth factor receptor
10	9606.ENSP00000320239	0.714	Transient receptor potential cation channel subfamily M member 7
11	9606.ENSP00000354006	0.689	Transient receptor potential cation channel subfamily M member 6
12	9606.ENSP00000295400	0.679	Protransforming growth factor alpha
13	9606.ENSP00000252244	0.640	Keratin, type II cytoskeletal 1
14	9606.ENSP00000437849	0.638	Transient receptor potential cation channel subfamily M member 1
15	9606.ENSP00000265709	0.581	Ankyrin-1
16	9606.ENSP00000264079	0.539	Mucolipin-1
17	9606.ENSP00000378207	0.524	A-kinase anchor protein 5
18	9606.ENSP00000394033	0.524	Potassium channel subfamily K member 2
19	9606.ENSP00000325296	0.520	Polycystic kidney disease 2-like 1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005262	1.000	calcium channel activity
GO:0042802	0.999	identical protein binding
GO:0022839	0.669	monoatomic ion gated channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050896	0.975	response to stimulus
GO:0065007	0.972	biological regulation
GO:0051179	0.968	localization
GO:0050789	0.962	regulation of biological process
GO:0006810	0.931	transport
GO:0055085	0.876	transmembrane transport
GO:0006811	0.858	monoatomic ion transport
GO:0098662	0.850	inorganic cation transmembrane transport
GO:0034220	0.844	monoatomic ion transmembrane transport
GO:0006812	0.825	monoatomic cation transport
GO:0030001	0.815	metal ion transport
GO:0098655	0.765	monoatomic cation transmembrane transport
GO:0009628	0.750	response to abiotic stimulus
GO:0006950	0.731	response to stress
GO:0006816	0.727	calcium ion transport
GO:0048518	0.705	positive regulation of biological process
GO:0070588	0.594	calcium ion transmembrane transport
GO:0050794	0.561	regulation of cellular process
GO:0009266	0.469	response to temperature stimulus
GO:0032501	0.396	multicellular organismal process
GO:0051716	0.362	cellular response to stimulus
GO:0048522	0.329	positive regulation of cellular process
GO:0051924	0.319	regulation of calcium ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.995	plasma membrane
GO:0032991	0.634	protein-containing complex
GO:0005622	0.327	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]