StarFunc result for job id Q8NEU8

User Input

>input (664 residues)
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQ
LSKQLLAYEKQNFALGKGDEEVISTLHYFSKVVDELNLLHTELAKQLADTMVLPIIQFRE
KDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQHLSSLQ
YYCALNALQYRKQMAMMEPMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVEL
EAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQKAGYLNLRNKTGLVTTTWERL
YFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESR
KENEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCPSQNLKNS
EMENENDKIVPKATASLPEAEELIAPGTPIQFDIVLPATEFLDQNRGSRRTNPFGETEDE
SFPEAEDSLLQQMFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRMTESHLMVT
SQSLRLIDPQTQVSRANFELTSVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNS
EGEKICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGNPNEHRGA
ESEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NEU8	1.000	1.000	0.000	664	1.000	1.000	Q8NEU8.pdb.gz	DP13B_HUMAN DCC-interacting protein 13-beta OS=Homo sapiens OX=9606 GN=APPL2 PE=1 SV=3
2	AFDB:B2XCM0	0.678	0.680	1.258E-80	662	0.694	0.696	B2XCM0.pdb.gz	B2XCM0_DANRE Appl2 OS=Danio rerio OX=7955 GN=appl2 PE=1 SV=1
3	AFDB:Q9UKG1	0.651	0.614	2.654E-66	709	0.532	0.498	Q9UKG1.pdb.gz	DP13A_HUMAN DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1
4	AFDB:A0A2R8QM99	0.538	0.500	5.272E-66	718	0.523	0.483	A0A2R8QM99.pdb.gz
5	AFDB:Q3UH98	0.460	0.374	9.379E-20	833	0.139	0.110	Q3UH98.pdb.gz	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
6	AFDB:Q15057	0.466	0.402	1.458E-19	778	0.148	0.126	Q15057.pdb.gz	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
7	AFDB:Q551Q8	0.434	0.350	2.380E-19	843	0.152	0.120	Q551Q8.pdb.gz	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
8	AFDB:Q9VCQ6	0.481	0.390	1.864E-18	828	0.123	0.099	Q9VCQ6.pdb.gz	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
9	AFDB:Q15027	0.446	0.405	4.972E-17	740	0.123	0.111	Q15027.pdb.gz	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
10	AFDB:Q9FIT8	0.385	0.320	6.352E-17	828	0.136	0.109	Q9FIT8.pdb.gz	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
11	PDB:7c3mA	0.130	0.146	4.387E-5	577	0.075	0.087	7c3mA.pdb.gz
12	PDB:6u3eA	0.134	0.217	5.605E-5	397	0.042	0.071	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
13	PDB:3ljuX	0.130	0.221	1.647E-4	373	0.059	0.105	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
14	PDB:4mk0A	0.130	0.137	2.689E-4	631	0.063	0.067	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:6bbpA	0.126	0.160	3.609E-4	520	0.041	0.052	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
16	PDB:3pvuA	0.122	0.132	5.086E-4	609	0.060	0.066	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:7rx9A	0.130	0.194	5.609E-4	432	0.075	0.116	7rx9A.pdb.gz
18	PDB:3uzsA	0.134	0.145	9.617E-4	609	0.042	0.046	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
19	PDB:4mt6A	0.137	0.227	1.229E-3	389	0.056	0.095	4mt6A.pdb.gz
20	PDB:6ikoA	0.121	0.243	1.649E-3	303	0.048	0.106	6ikoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZXF9	0.0	606	644	0.470	0.484	A0A8I5ZXF9_RAT Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 OS=Rattus norvegicus OX=10116 GN=Appl1 PE=1 SV=1
2	B2XCL9	0.0	688	707	0.530	0.498	B2XCL9_DANRE Appl1 OS=Danio rerio OX=7955 GN=appl1 PE=1 SV=1
3	B2XCM0	0.0	942	662	0.696	0.698	B2XCM0_DANRE Appl2 OS=Danio rerio OX=7955 GN=appl2 PE=1 SV=1
4	D3ZWA8	0.0	705	707	0.514	0.482	D3ZWA8_RAT Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 OS=Rattus norvegicus OX=10116 GN=Appl1 PE=1 SV=4
5	F1RB27	0.0	942	662	0.696	0.698	F1RB27_DANRE Adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper-containing 2 OS=Danio rerio OX=7955 GN=appl2 PE=1 SV=1
6	Q8K3G9	0.0	1275	662	0.925	0.927	DP13B_MOUSE DCC-interacting protein 13-beta OS=Mus musculus OX=10090 GN=Appl2 PE=1 SV=1
7	Q8K3H0	0.0	706	707	0.515	0.484	DP13A_MOUSE DCC-interacting protein 13-alpha OS=Mus musculus OX=10090 GN=Appl1 PE=1 SV=1
8	Q8NEU8	0.0	1379	664	1.000	1.000	DP13B_HUMAN DCC-interacting protein 13-beta OS=Homo sapiens OX=9606 GN=APPL2 PE=1 SV=3
9	Q9UKG1	0.0	706	709	0.518	0.485	DP13A_HUMAN DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1
10	Q6ZQK5	1.53e-22	105	770	0.145	0.125	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
11	Q15057	2.07e-22	104	778	0.145	0.123	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
12	Q5FVC7	2.90e-22	104	770	0.145	0.125	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
13	A2ADA6	1.17e-21	102	829	0.146	0.117	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
14	Q3UH98	1.67e-21	102	833	0.151	0.120	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
15	Q6NXL5	2.10e-21	101	833	0.151	0.120	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
16	Q4QQN0	2.71e-21	100	626	0.151	0.160	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
17	Q551Q8	7.80e-17	87.0	843	0.140	0.110	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
18	Q9VCQ6	2.37e-14	79.0	828	0.130	0.104	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
19	Q8T0R1	2.79e-14	79.0	767	0.130	0.112	Q8T0R1_DROME GH12888p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
20	Q6Y5D8	4.37e-14	78.2	786	0.125	0.106	RHG10_MOUSE Rho GTPase-activating protein 10 OS=Mus musculus OX=10090 GN=Arhgap10 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16746 BAR_3	1.9e-66	235.6	BAR domain of APPL family
2	PF11662 DUF3263	1.9e+02	13.3	Protein of unknown function (DUF3263)
3	PF00169 PH	3.2e-07	42.1	PH domain
4	PF18012 PH_17	1.5e+02	13.6	PH domain
5	PF08458 PH_2	3.4e+02	13.0	Plant pleckstrin homology-like region
6	PF15410 PH_9	52	15.5	Pleckstrin homology domain
7	PF00640 PID	0.00087	30.8	Phosphotyrosine interaction domain (PTB/PID)
8	PF03396 Pox_RNA_pol_35	1.7e+02	12.9	Poxvirus DNA-directed RNA polymerase, 35 kD subunit
9	PF08416 PTB	1.7	20.2	Phosphotyrosine-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012832

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000024028	0.954	Adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
2	9593.ENSGGOP00000001383	0.804	V-akt murine thymoma viral oncogene homolog 2
3	9593.ENSGGOP00000007562	0.804	V-akt murine thymoma viral oncogene homolog 3
4	9593.ENSGGOP00000017521	0.804	V-akt murine thymoma viral oncogene homolog 1
5	9593.ENSGGOP00000027811	0.751	RAB5C, member RAS oncogene family
6	9593.ENSGGOP00000015584	0.741	RAB5A, member RAS oncogene family
7	9593.ENSGGOP00000025258	0.741	RAB5B, member RAS oncogene family
8	9593.ENSGGOP00000015151	0.727	RAB22A, member RAS oncogene family
9	9593.ENSGGOP00000011036	0.717	ADP-ribosylation factor 6
10	9593.ENSGGOP00000012134	0.717	ADP-ribosylation factor-like 15
11	9593.ENSGGOP00000012285	0.715	RAB20, member RAS oncogene family
12	9593.ENSGGOP00000014720	0.715	RAB17, member RAS oncogene family
13	9593.ENSGGOP00000018644	0.715	RAB24, member RAS oncogene family
14	9593.ENSGGOP00000027737	0.715	RAB31, member RAS oncogene family
15	9593.ENSGGOP00000003614	0.671	RAB, member of RAS oncogene family like 2A
16	9593.ENSGGOP00000025229	0.671	RAB, member of RAS oncogene family like 2B
17	9593.ENSGGOP00000001134	0.628	Inositol polyphosphate-5-phosphatase, 75kDa
18	9593.ENSGGOP00000021171	0.618	Clathrin heavy chain
19	9593.ENSGGOP00000024160	0.618	Clathrin heavy chain
20	9593.ENSGGOP00000028681	0.614	Clathrin heavy chain linker domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005543	0.638	phospholipid binding
GO:0044877	0.431	protein-containing complex binding
GO:0035091	0.348	phosphatidylinositol binding
GO:0001786	0.316	phosphatidylserine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0007166	0.977	cell surface receptor signaling pathway
GO:0010827	0.937	regulation of glucose transmembrane transport
GO:0046324	0.934	regulation of glucose import
GO:0048518	0.903	positive regulation of biological process
GO:0048523	0.901	negative regulation of cellular process
GO:0071840	0.832	cellular component organization or biogenesis
GO:0016043	0.816	cellular component organization
GO:0071495	0.729	cellular response to endogenous stimulus
GO:0051179	0.655	localization
GO:0006810	0.645	transport
GO:0071363	0.640	cellular response to growth factor stimulus
GO:0051051	0.632	negative regulation of transport
GO:0051649	0.514	establishment of localization in cell
GO:0048522	0.498	positive regulation of cellular process
GO:0007167	0.485	enzyme-linked receptor protein signaling pathway
GO:0046907	0.413	intracellular transport
GO:0032501	0.368	multicellular organismal process
GO:0019222	0.358	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	1.000	endosome
GO:0016020	0.981	membrane
GO:0071944	0.970	cell periphery
GO:0005886	0.960	plasma membrane
GO:0031090	0.924	organelle membrane
GO:0005829	0.919	cytosol
GO:0005576	0.854	extracellular region
GO:0012506	0.837	vesicle membrane
GO:0030659	0.834	cytoplasmic vesicle membrane
GO:0098588	0.831	bounding membrane of organelle
GO:0043230	0.732	extracellular organelle
GO:0005769	0.709	early endosome
GO:0065010	0.685	extracellular membrane-bounded organelle
GO:0010008	0.681	endosome membrane
GO:1903561	0.639	extracellular vesicle
GO:0070062	0.604	extracellular exosome
GO:0005634	0.526	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]