StarFunc result for job id Q8NEV4

User Input

>input (1616 residues)
MFPLIGKTIIFDNFPDPSDTWEITETIGKGTYGKVFKVLNKKNGQKAAVKILDPIHDIDE
EIEAEYNILKALSDHPNVVRFYGIYFKKDKVNGDKLWLVLELCSGGSVTDLVKGFLKRGE
RMSEPLIAYILHEALMGLQHLHNNKTIHRDVKGNNILLTTEGGVKLVDFGVSAQLTSTRH
RRNTSVGTPFWMAPEVIACEQQLDTTYDARCDTWSLGITAIELGDGDPPLADLHPMRALF
KIPRNPPPKLRQPELWSAEFNDFISKCLTKDYEKRPTVSELLQHKFITQIEGKDVMLQKQ
LTEFIGIHQCMGGTEKARRERIHTKKGNFNRPLISNLKDVDDLATLEILDENTVSEQLEK
CYSRDQIYVYVGDILIALNPFQSLGLYSTKHSKLYIGSKRTASPPHIFAMADLGYQSMIT
YNSDQCIVISGESGAGKTENAHLLVQQLTVLGKANNRTLQEKILQVNNLVEAFGNACTII
NDNSSRFGKYLEMKFTSSGAVVGAQISEYLLEKSRVIHQAIGEKNFHIFYYIYAGLAEKK
KLAHYKLPENKPPRYLQNDHLRTVQDIMNNSFYKSQYELIEQCFKVIGFTMEQLGSIYSI
LAAILNVGNIEFSSVATEHQIDKSHISNHTALENCASLLCIRADELQEALTSHCVVTRGE
TIIRPNTVEKATDVRDAMAKTLYGRLFSWIVNCINSLLKHDSSPSGNGDELSIGILDIFG
FENFKKNSFEQLCINIANEQIQYYYNQHVFAWEQNEYLNEDVDARVIEYEDNWPLLDMFL
QKPMGLLSLLDEESRFPKATDQTLVEKFEGNLKSQYFWRPKRMELSFGIHHYAGKVLYNA
SGFLAKNRDTLPTDIVLLLRSSDNSVIRQLVNHPLTKTGNLPHSKTKNVINYQMRTSEKL
INLAKGDTGEATRHARETTNMKTQTVASYFRYSLMDLLSKMVVGQPHFVRCIKPNSERQA
RKYDKEKVLLQLRYTGILETARIRRLGFSHRILFANFIKRYYLLCYKSSEEPRMSPDTCA
TILEKAGLDNWALGKTKVFLKYYHVEQLNLMRKEAIDKLILIQACVRAFLCSRRYQKIQE
KRKESAIIIQSAARGHLVRKQRKEIVDMKNTAVTTIQTSDQEFDYKKNFENTRESFVKKQ
AENAISANERFISAPNNKGSVSVVKTSTFKPEEETTNAVESNNRVYQTPKKMNNVYEEEV
KQEFYLVGPEVSPKQKSVKDLEENSNLRKVEKEEAMIQSYYQRYTEERNCEESKAAYLER
KAISERPSYPVPWLAENETSFKKTLEPTLSQRSIYQNANSMEKEKKTSVVTQRAPICSQE
EGRGRLRHETVKERQVEPVTQAQEEEDKAAVFIQSKYRGYKRRQQLRKDKMSSFKHQRIV
TTPTEVARNTHNLYSYPTKHEEINNIKKKDNKDSKATSEREACGLAIFSKQISKLSEEYF
ILQKKLNEMILSQQLKSLYLGVSHHKPINRRVSSQQCLSGVCKGEEPKILRPPRRPRKPK
TLNNPEDSTYYYLLHKSIQEEKRRPRKDSQGKLLDLEDFYYKEFLPSRSGPKEHSPSLRE
RRPQQELQNQCIKANERCWAAESPEKEEEREPAANPYDFRRLLRKTSQRRRLVQQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1EG27	0.468	0.576	0.000	1305	0.452	0.560	Q1EG27.pdb.gz	MYO3B_MOUSE Myosin-IIIb OS=Mus musculus OX=10090 GN=Myo3b PE=1 SV=2
2	AFDB:Q8K3H5	0.564	0.565	0.000	1613	0.812	0.814	Q8K3H5.pdb.gz	MYO3A_MOUSE Myosin-IIIa OS=Mus musculus OX=10090 GN=Myo3a PE=1 SV=1
3	AFDB:Q8NEV4	1.000	1.000	0.000	1616	1.000	1.000	Q8NEV4.pdb.gz	MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens OX=9606 GN=MYO3A PE=1 SV=2
4	AFDB:Q8WXR4	0.468	0.562	0.000	1341	0.462	0.556	Q8WXR4.pdb.gz	MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens OX=9606 GN=MYO3B PE=1 SV=4
5	AFDB:P10676	0.420	0.451	5.640E-89	1501	0.255	0.274	P10676.pdb.gz	NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster OX=7227 GN=ninaC PE=1 SV=2
6	AFDB:Q13459	0.410	0.310	1.397E-67	2157	0.223	0.167	Q13459.pdb.gz	MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3
7	AFDB:B2RTY4	0.412	0.265	6.899E-67	2548	0.235	0.149	B2RTY4.pdb.gz	MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A PE=1 SV=2
8	AFDB:E7EZG2	0.408	0.265	2.339E-66	2522	0.238	0.152	E7EZG2.pdb.gz	MY9AA_DANRE Unconventional myosin-IXAa OS=Danio rerio OX=7955 GN=myo9aa PE=3 SV=1
9	AFDB:Q9U1M8	0.372	0.260	6.888E-66	2357	0.221	0.151	Q9U1M8.pdb.gz	MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoI PE=1 SV=1
10	AFDB:P91443	0.383	0.298	2.685E-64	2098	0.183	0.141	P91443.pdb.gz	HUM6_CAEEL Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans OX=6239 GN=hum-6 PE=1 SV=1
11	PDB:4anjA	0.370	0.592	2.465E-51	995	0.146	0.237	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
12	PDB:4pa0A	0.336	0.544	1.613E-50	974	0.152	0.252	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.338	0.576	1.772E-50	920	0.150	0.263	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:6ycxB	0.397	0.766	3.931E-49	817	0.129	0.256	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
15	PDB:4p7hB	0.336	0.554	9.140E-48	952	0.149	0.252	4p7hB.pdb.gz
16	PDB:7mf3B	0.389	0.679	3.546E-43	896	0.170	0.306	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.368	0.598	5.140E-40	954	0.165	0.279	5tbyA.pdb.gz
18	PDB:3eqdA	0.154	0.730	1.851E-17	315	0.058	0.298	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
19	PDB:4eomC	0.148	0.807	1.051E-15	276	0.049	0.286	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:6byrA	0.150	0.573	1.209E-15	405	0.057	0.227	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10676	0.0	631	1501	0.249	0.268	NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster OX=7227 GN=ninaC PE=1 SV=2
2	Q1EG27	0.0	1488	1305	0.433	0.536	MYO3B_MOUSE Myosin-IIIb OS=Mus musculus OX=10090 GN=Myo3b PE=1 SV=2
3	Q8K3H5	0.0	2668	1613	0.816	0.818	MYO3A_MOUSE Myosin-IIIa OS=Mus musculus OX=10090 GN=Myo3a PE=1 SV=1
4	Q8NEV4	0.0	3373	1616	1.000	1.000	MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens OX=9606 GN=MYO3A PE=1 SV=2
5	Q8WXR4	0.0	1528	1341	0.446	0.537	MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens OX=9606 GN=MYO3B PE=1 SV=4
6	Q9DG88	0.0	1763	1838	0.517	0.454	Q9DG88_MORSA Myosin heavy chain FM3A OS=Morone saxatilis OX=34816 GN=FM3A PE=2 SV=1
7	Q9DGG9	3.65e-154	523	2179	0.196	0.145	Q9DGG9_DANRE Myosin VIIA OS=Danio rerio OX=7955 GN=myo7A PE=2 SV=1
8	Q13402	2.42e-152	518	2215	0.191	0.140	MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens OX=9606 GN=MYO7A PE=1 SV=2
9	Q8CJE3	4.16e-150	511	2177	0.193	0.143	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
10	Q8IPH7	5.70e-150	488	1034	0.183	0.286	Q8IPH7_DROME Myosin 28B1, isoform C OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=2
11	Q8IPH6	6.09e-150	488	1033	0.183	0.287	Q8IPH6_DROME FI20293p1 OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=2
12	A0A8I5ZWB0	6.23e-150	511	2238	0.193	0.139	A0A8I5ZWB0_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
13	Q7YU72	6.60e-150	488	1035	0.183	0.286	Q7YU72_DROME RH39293p OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=1
14	A0A8J8XYU9	7.16e-150	510	2215	0.193	0.141	A0A8J8XYU9_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
15	Q99MZ6	8.27e-150	509	2113	0.189	0.145	MYO7B_MOUSE Unconventional myosin-VIIb OS=Mus musculus OX=10090 GN=Myo7b PE=1 SV=3
16	P97479	9.18e-150	510	2215	0.189	0.138	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2
17	Q9U1M8	6.12e-149	509	2357	0.188	0.129	MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoI PE=1 SV=1
18	Q6PIF6	1.31e-147	503	2116	0.186	0.142	MYO7B_HUMAN Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B PE=1 SV=2
19	I3ITL5	2.58e-143	490	2041	0.186	0.147	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
20	Q9UKN7	3.08e-143	493	3530	0.179	0.082	MYO15_HUMAN Unconventional myosin-XV OS=Homo sapiens OX=9606 GN=MYO15A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	23	16.7	AAA domain
2	PF03109 ABC1	0.43	21.2	ABC1 atypical kinase-like domain
3	PF01636 APH	1e+02	14.2	Phosphotransferase enzyme family
4	PF07475 Hpr_kinase_C	2.8e+02	12.4	HPr Serine kinase C-terminal domain
5	PF00612 IQ	3.6e-07	40.4	IQ calmodulin-binding motif
6	PF14531 Kinase-like	1.4	19.8	Kinase-like
7	PF00063 Myosin_head	3.3e-199	675.1	Myosin head (motor domain)
8	PF00069 Pkinase	2.3e-57	206.0	Protein kinase domain
9	PF17667 Pkinase_fungal	0.06	23.7	Fungal protein kinase
10	PF07714 PK_Tyr_Ser-Thr	2.1e-41	153.5	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265944

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352834	0.959	Unconventional myosin-Ic
2	9606.ENSP00000307636	0.954	MORN repeat-containing protein 4
3	9606.ENSP00000367059	0.953	Espin
4	9606.ENSP00000358994	0.950	Unconventional myosin-VI
5	9606.ENSP00000393392	0.934	Unconventional myosin-Ia
6	9606.ENSP00000253754	0.914	PDZ and LIM domain protein 4
7	9606.ENSP00000352264	0.914	CD2-associated protein
8	9606.ENSP00000304283	0.913	Ras-related C3 botulinum toxin substrate 3
9	9606.ENSP00000297784	0.818	Transmembrane channel-like protein 1
10	9606.ENSP00000397459	0.759	Dual specificity protein phosphatase 22
11	9606.ENSP00000343690	0.742	Dihydropyrimidinase-related protein 3
12	9606.ENSP00000299106	0.720	Junctional adhesion molecule C
13	9606.ENSP00000331983	0.720	F-actin-uncapping protein LRRC16A
14	9606.ENSP00000339115	0.703	Espin-like protein
15	9606.ENSP00000303908	0.702	Twinfilin-2
16	9606.ENSP00000262717	0.701	Cadherin-20
17	9606.ENSP00000363068	0.696	Protocadherin-15
18	9606.ENSP00000281172	0.692	Epidermal growth factor receptor kinase substrate 8
19	9606.ENSP00000419740	0.687	5-methylcytosine rRNA methyltransferase NSUN4
20	9606.ENSP00000482885	0.686	Phosphatidylinositol phosphatase PTPRQ

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000146	1.000	microfilament motor activity
GO:0004672	1.000	protein kinase activity
GO:0005516	0.999	calmodulin binding
GO:0004674	0.989	protein serine/threonine kinase activity
GO:1901265	0.952	nucleoside phosphate binding
GO:0008092	0.951	cytoskeletal protein binding
GO:0030554	0.886	adenyl nucleotide binding
GO:0032559	0.884	adenyl ribonucleotide binding
GO:0043168	0.861	anion binding
GO:0003779	0.760	actin binding
GO:0043531	0.504	ADP binding
GO:0005524	0.365	ATP binding
GO:0044877	0.303	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044238	0.978	primary metabolic process
GO:1901564	0.976	organonitrogen compound metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0006793	0.973	phosphorus metabolic process
GO:0036211	0.971	protein modification process
GO:0003008	0.969	system process
GO:0007600	0.963	sensory perception
GO:0007605	0.953	sensory perception of sound
GO:0046777	0.951	protein autophosphorylation
GO:0065007	0.810	biological regulation
GO:0050789	0.800	regulation of biological process
GO:0050794	0.760	regulation of cellular process
GO:0071840	0.523	cellular component organization or biogenesis
GO:0016043	0.459	cellular component organization
GO:0048518	0.437	positive regulation of biological process
GO:0032502	0.382	developmental process
GO:0048856	0.354	anatomical structure development
GO:0048522	0.322	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0120025	0.996	plasma membrane bounded cell projection
GO:0098858	0.988	actin-based cell projection
GO:0005829	0.981	cytosol
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0032991	0.976	protein-containing complex
GO:0032433	0.965	filopodium tip
GO:0043227	0.917	membrane-bounded organelle
GO:0016020	0.877	membrane
GO:0005856	0.861	cytoskeleton
GO:0015629	0.814	actin cytoskeleton
GO:0099081	0.685	supramolecular polymer
GO:0099512	0.684	supramolecular fiber
GO:0043231	0.597	intracellular membrane-bounded organelle
GO:0099513	0.416	polymeric cytoskeletal fiber
GO:0005884	0.393	actin filament
GO:0043005	0.391	neuron projection
GO:0071944	0.377	cell periphery
GO:0031941	0.356	filamentous actin
GO:0001917	0.350	photoreceptor inner segment
GO:0032420	0.336	stereocilium
GO:0032426	0.310	stereocilium tip

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	1.000	myosin ATPase.
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]