StarFunc result for job id Q8NEV8

User Input

>input (1989 residues)
MTKVPPAFDFSFLNDEEARKILQVLERNEELQRAEKDRISKLQKTKRDIRWLQGVTGEWF
EEIQRKKFCNETDVSQMLKQPLTYRLSKEMAKNDPIELPTSRSKNVTNQKKPTPFSSRMS
FRSSFASLFSFRKSGKETSKLPSLGQKGCDGHAGPPMPVRGAAVQAKIYNSPLENHLVDS
TFVPKPAVMREESGMPPPWDASLLENEFFQVLDDLDSKLAQEQSASSVNTRTPLNYGSRT
QFGHFYSSGNRHGNITERHKKHYNETSNMSIYDILRPGTPREGFKTFSPRTSTIYDMYRT
REPRVFKEDYVQKNTFGSTSLCFDSRQRSALPATGHFTARSLHFPATTQSKSGFIPPRHQ
QSPKRTPLSSIIWNRSDSSRDRENQEEFLRAPSPMEIDPADKYVYPRGFQENKRYESYHS
QNVYQRVSLNAPMENAMSPDTFENSENMPFYHQSNTFTRSFFSNTFGRSGEQRRFGQGPF
WGQEKGHSFWSDFHRSRKSFSSSDRDFEMISMEANSVSAIHGHNVSSEHWESFSSGYGTD
VSRGQEEPHPWQFDFQRSTLDSMVVSHGNETQLTPHFGTPNVCSMTGSSYHVKSSELVSQ
QDSSPVEVHINKEASSFGIAQTLASSFKTSFSQISDDRRNPQSPNLQNPTVTLQKIFPNK
PASHPMRSHTEVTVTSSNSVDSLPLAKSQPNILVTEVNNEKDLNESISEEDKQLSKMDQT
NKAGEIPQPVSQTGISNSLPDFQNPLSQDSAKSNGFGFNASTIISSKKSPRVFSRKDTSK
MYIPHTDKSNDIKQDKRFTENRKLGSTASLPFIQEHRTPPSFPRTDQGCHQELTVNNEDI
SRIITNNHWSSALTDTQNAQYSKCKLTPGHKTSCDSLDLSSAALPDSSPSKNSSLDAPVV
PSTTVFSRRSPSDKDPSLGEREEKDNAGKNQKNQFIVSHSENQERNDSPVPTHDEVVDVK
CHSHSPFRNERGKGKIRHHISCIEKLSKTESISVPTSDHRSLIEANQSNSKVSELDTIYC
TLPRKSSSFLIHGRQSGSKIMAASLRNGPPPFQIKNNVEDAMGNYMLNKFSPSSPESANE
CSKVLSDSALEAPEATERMTNVKSSGSTSVRKGPLPFLINRAMSCPSGEPHASTGREGRK
KPLTSGMDASELTPRAWERIISPVESDSSVRDCSLTKRQHQKENFQEYTEKEGKMAASRR
SVFALSNEDPLPFCSDLSGKERGKTLHKVKTTSTFSVSGDEDNVKCLEVVSIYYTLPRKP
SKKFCNLLQQYTQNTNLLIESPQVETETFPNALEKDKQNYSTREQSGTPSCENLKMSVNS
DQTLTTENMTAFRLSNRGPLAPTLQEMASVEAAVSLPEEESKAREIFSDNLAKTPLGDSE
NKKERGKKLQSETLHTSLMLQRKNVSEEKSENCQQSINSSNSGPSSLPALSEVNIGNSQT
RRSSWECTGSGRAIPFTGSGKCPQKDHTSTAVGDGSSGSQPREGRGDIGTNCQKMTNKTL
SHSESQVFALTPALHKLQLGEETQSDEPNLESLQSEPRELPQRSQEANMTESRKAEDEMQ
KSAWDQPSLPEGNKNKTNLDDLVKGENRSSVKHRLAAMSKASRKFPAKDVSPRRHVATIF
PQSGSRSGFDHLSLGTVECNPLFPEPTPKSAESIGESRLSENGKHVKKSENLLPITVLPN
REPSTHVSNQKSNSISQRHQNEFKNVSESPSKHENSKDVTAAQNLVRESGAPSPITFTSL
REAEFSDNQRRLSPPFPLEPAQKSRVSSPLASFLQQQRSASSLEWEPEPHLYRSKSLKSI
NVHGDLLRKSHPPKVRERHFSESTSIDNALSRLTLGNEFSVNNGYSRRFRSFSELPSCDG
NESWAYRSGTKTGPRSAISIYRPIDYGIFGKEQQLAFLENVKRSLTQGRLWKPSFLKNPG
FLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPLNIYEDDPVDSNCDTDTTTDDEYYL
DENDKESEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0VAV2	0.130	0.131	0.000	1960	0.576	0.585	Q0VAV2.pdb.gz	EXPH5_MOUSE Exophilin-5 OS=Mus musculus OX=10090 GN=Exph5 PE=1 SV=1
2	AFDB:Q8NEV8	1.000	1.000	0.000	1989	1.000	1.000	Q8NEV8.pdb.gz	EXPH5_HUMAN Exophilin-5 OS=Homo sapiens OX=9606 GN=EXPH5 PE=1 SV=4
3	AFDB:Q68DE3	0.030	0.028	3.786E-3	2245	0.153	0.136	Q68DE3.pdb.gz	USF3_HUMAN Basic helix-loop-helix domain-containing protein USF3 OS=Homo sapiens OX=9606 GN=USF3 PE=1 SV=4
4	AFDB:E7FF48	0.031	0.028	9.534E-3	2315	0.141	0.121	E7FF48.pdb.gz	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
5	AFDB:Q9HCM3	0.028	0.029	2.767E-2	1950	0.138	0.141	Q9HCM3.pdb.gz	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
6	AFDB:D3ZXN9	0.035	0.030	3.424E-2	2472	0.147	0.119	D3ZXN9.pdb.gz	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
7	AFDB:Q8NFD5	0.034	0.032	3.676E-2	2236	0.145	0.129	Q8NFD5.pdb.gz	ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=3
8	AFDB:Q8IJP9	0.034	0.031	7.479E-2	2578	0.127	0.098	Q8IJP9.pdb.gz	Q8IJP9_PLAF7 Transcriptional coactivator ADA2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1014600 PE=4 SV=1
9	AFDB:Q68FD9	0.028	0.028	9.936E-2	1940	0.135	0.139	Q68FD9.pdb.gz	K1549_MOUSE UPF0606 protein KIAA1549 OS=Mus musculus OX=10090 GN=Kiaa1549 PE=1 SV=3
10	AFDB:O88466	0.032	0.033	1.417E-1	1888	0.122	0.128	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
11	PDB:2jowA	0.031	0.287	2.968	83	0.008	0.193	2jowA.pdb.gz
12	PDB:6ql7M	0.028	0.269	3.186	113	0.011	0.186	6ql7M.pdb.gz
13	PDB:4n78D	0.020	0.133	3.421	202	0.012	0.119	4n78D.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
14	PDB:7z37DP1	0.022	0.118	6.483	273	0.009	0.062	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
15	PDB:7bl1AAA	0.020	0.094	8.022	380	0.009	0.045	7bl1AAA.pdb.gz	Structural basis for VPS34 kinase activation by Rab1 and Rab5 on membranes.
16	PDB:6jcxF	0.018	0.116	9.247	186	0.010	0.108	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
17	PDB:4v60A	0.025	0.049	9.927	812	0.008	0.020	4v60A.pdb.gz
18	PDB:6bk8K	0.021	0.335	9.927	82	0.003	0.073	6bk8K.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VAV2	0.0	1962	1960	0.578	0.586	EXPH5_MOUSE Exophilin-5 OS=Mus musculus OX=10090 GN=Exph5 PE=1 SV=1
2	Q8NEV8	0.0	4101	1989	0.999	0.999	EXPH5_HUMAN Exophilin-5 OS=Homo sapiens OX=9606 GN=EXPH5 PE=1 SV=4
3	Q99N50	6.16e-06	53.9	950	0.012	0.025	SYTL2_MOUSE Synaptotagmin-like protein 2 OS=Mus musculus OX=10090 GN=Sytl2 PE=1 SV=2
4	Q9HCH5	6.79e-06	53.9	934	0.012	0.025	SYTL2_HUMAN Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2 PE=1 SV=3
5	Q8IYJ3	5.29e-05	50.4	562	0.012	0.043	SYTL1_HUMAN Synaptotagmin-like protein 1 OS=Homo sapiens OX=9606 GN=SYTL1 PE=1 SV=1
6	Q99N80	1.37e-04	49.3	567	0.012	0.042	SYTL1_MOUSE Synaptotagmin-like protein 1 OS=Mus musculus OX=10090 GN=Sytl1 PE=1 SV=2
7	Q96C24	0.082	40.4	671	0.009	0.027	SYTL4_HUMAN Synaptotagmin-like protein 4 OS=Homo sapiens OX=9606 GN=SYTL4 PE=1 SV=2
8	Q9R0Q1	0.24	38.9	673	0.009	0.027	SYTL4_MOUSE Synaptotagmin-like protein 4 OS=Mus musculus OX=10090 GN=Sytl4 PE=1 SV=1
9	Q7X9V2	0.25	38.9	2055	0.017	0.017	PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana OX=3702 GN=PIE1 PE=1 SV=1
10	Q8VHQ7	0.25	38.9	672	0.009	0.027	SYTL4_RAT Synaptotagmin-like protein 4 OS=Rattus norvegicus OX=10116 GN=Sytl4 PE=1 SV=1
11	Q80T23	0.46	37.7	753	0.010	0.025	SYTL5_MOUSE Synaptotagmin-like protein 5 OS=Mus musculus OX=10090 GN=Sytl5 PE=1 SV=1
12	Q8TDW5	0.57	37.7	730	0.010	0.026	SYTL5_HUMAN Synaptotagmin-like protein 5 OS=Homo sapiens OX=9606 GN=SYTL5 PE=1 SV=1
13	Q4VX76	0.77	37.0	610	0.009	0.030	SYTL3_HUMAN Synaptotagmin-like protein 3 OS=Homo sapiens OX=9606 GN=SYTL3 PE=1 SV=3
14	Q8K3I4	2.4	35.8	856	0.007	0.016	MYRIP_MOUSE Rab effector MyRIP OS=Mus musculus OX=10090 GN=Myrip PE=1 SV=1
15	Q7TNY7	2.5	35.4	856	0.007	0.016	MYRIP_RAT Rab effector MyRIP OS=Rattus norvegicus OX=10116 GN=Myrip PE=1 SV=1
16	Q8NFW9	4.1	35.0	859	0.007	0.016	MYRIP_HUMAN Rab effector MyRIP OS=Homo sapiens OX=9606 GN=MYRIP PE=1 SV=2
17	Q5XI99	4.4	34.7	408	0.017	0.081	LAMP3_RAT Lysosome-associated membrane glycoprotein 3 OS=Rattus norvegicus OX=10116 GN=Lamp3 PE=2 SV=1
18	A2BHD8	5.4	34.3	541	0.016	0.057	A2BHD8_DANRE Beta-hexosaminidase OS=Danio rerio OX=7955 GN=fc04h11 PE=1 SV=1
19	Q98953	8.1	31.2	92	0.011	0.239	S10A6_CHICK Protein S100-A6 OS=Gallus gallus OX=9031 GN=S100A6 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10062 DUF2300	2.2e+02	13.4	Predicted secreted protein (DUF2300)
2	PF02318 FYVE_2	14	17.3	FYVE-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265843

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379601	0.933	Ras-related protein Rab-27A
2	9606.ENSP00000483537	0.744	Uncharacterized protein C11orf65
3	9606.ENSP00000264605	0.731	Melanophilin
4	9606.ENSP00000328426	0.702	Protein FAM208B
5	9606.ENSP00000362080	0.702	Synaptotagmin-like protein 4
6	9606.ENSP00000262094	0.698	Ras-related protein Rab-27B
7	9606.ENSP00000389843	0.669	Sodium-coupled neutral amino acid transporter 4
8	9606.ENSP00000319096	0.648	Ras-related protein Rap-2b
9	9606.ENSP00000256682	0.646	ADP-ribosylation factor 3
10	9606.ENSP00000317790	0.644	Spectrin beta, non-erythrocytic 5
11	9606.ENSP00000261205	0.643	Synaptotagmin-1
12	9606.ENSP00000315386	0.630	KDEL motif-containing protein 2
13	9606.ENSP00000355511	0.628	Rab proteins geranylgeranyltransferase component A 2
14	9606.ENSP00000328977	0.613	Rab effector Noc2
15	9606.ENSP00000369291	0.609	LETM1 domain-containing protein LETM2, mitochondrial
16	9606.ENSP00000367028	0.608	Treacle protein
17	9606.ENSP00000482826	0.608	Beta-soluble NSF attachment protein
18	9606.ENSP00000382177	0.575	Unconventional myosin-Va
19	9606.ENSP00000301972	0.562	Rab effector MyRIP
20	9606.ENSP00000278612	0.541	Protein NPAT

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.994	biological regulation
GO:0009987	0.989	cellular process
GO:0050789	0.963	regulation of biological process
GO:0050794	0.950	regulation of cellular process
GO:0006810	0.942	transport
GO:0048522	0.939	positive regulation of cellular process
GO:0016192	0.614	vesicle-mediated transport
GO:0017157	0.436	regulation of exocytosis
GO:0032502	0.413	developmental process
GO:0048856	0.385	anatomical structure development
GO:0045921	0.358	positive regulation of exocytosis
GO:0071985	0.328	multivesicular body sorting pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	0.996	endosome
GO:0016020	0.887	membrane
GO:0043232	0.529	intracellular non-membrane-bounded organelle
GO:0005829	0.492	cytosol
GO:0005634	0.381	nucleus
GO:0070013	0.371	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]