StarFunc result for job id Q8NEV9

User Input

>input (243 residues)
MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSE
VRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALL
GGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGL
LPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLS
PQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NEV9	1.000	1.000	1.643E-31	243	1.000	1.000	Q8NEV9.pdb.gz	IL27A_HUMAN Interleukin-27 subunit alpha OS=Homo sapiens OX=9606 GN=IL27 PE=1 SV=2
2	AFDB:D3ZPW3	0.740	0.767	3.400E-20	234	0.691	0.718	D3ZPW3.pdb.gz	D3ZPW3_RAT Interleukin 27 OS=Rattus norvegicus OX=10116 GN=Il27 PE=4 SV=1
3	AFDB:Q8K3I6	0.735	0.762	8.546E-20	234	0.716	0.744	Q8K3I6.pdb.gz	IL27A_MOUSE Interleukin-27 subunit alpha OS=Mus musculus OX=10090 GN=Il27 PE=1 SV=1
4	PDB:7u7nD	0.734	0.927	1.329E-19	191	0.786	1.000	7u7nD.pdb.gz
5	PDB:7zxkC	0.623	0.894	2.066E-17	166	0.679	0.994	7zxkC.pdb.gz
6	PDB:7z0lB	0.631	0.422	1.451E-12	370	0.531	0.349	7z0lB.pdb.gz
7	AFDB:Q9QZM3	0.587	0.631	2.009E-5	225	0.226	0.244	Q9QZM3.pdb.gz	CLCF1_MOUSE Cardiotrophin-like cytokine factor 1 OS=Mus musculus OX=10090 GN=Clcf1 PE=1 SV=1
8	AFDB:P26441	0.559	0.669	1.098E-4	200	0.169	0.205	P26441.pdb.gz	CNTF_HUMAN Ciliary neurotrophic factor OS=Homo sapiens OX=9606 GN=CNTF PE=1 SV=1
9	AFDB:P47873	0.569	0.683	1.783E-4	199	0.177	0.216	P47873.pdb.gz	IL11_MOUSE Interleukin-11 OS=Mus musculus OX=10090 GN=Il11 PE=1 SV=1
10	AFDB:P83714	0.596	0.699	2.385E-4	204	0.169	0.201	P83714.pdb.gz	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
11	AFDB:P20294	0.568	0.677	4.068E-4	200	0.156	0.190	P20294.pdb.gz	CNTF_RAT Ciliary neurotrophic factor OS=Rattus norvegicus OX=10116 GN=Cntf PE=1 SV=1
12	AFDB:P20809	0.564	0.679	4.939E-4	199	0.189	0.231	P20809.pdb.gz	IL11_HUMAN Interleukin-11 OS=Homo sapiens OX=9606 GN=IL11 PE=1 SV=1
13	AFDB:E5RWR3	0.505	0.532	5.713E-4	229	0.169	0.179	E5RWR3.pdb.gz	E5RWR3_MELGA Prolactin OS=Meleagris gallopavo OX=9103 GN=PRL PE=3 SV=1
14	PDB:6o4oA	0.532	0.739	4.197E-3	169	0.160	0.231	6o4oA.pdb.gz
15	PDB:1f6fA	0.400	0.515	1.220E-2	183	0.115	0.153	1f6fA.pdb.gz
16	PDB:1huwA	0.392	0.544	1.633E-2	166	0.115	0.169	1huwA.pdb.gz
17	PDB:1cnt2	0.450	0.807	1.889E-2	130	0.103	0.192	1cnt2.pdb.gz
18	PDB:1rw5A	0.497	0.590	1.889E-2	199	0.132	0.161	1rw5A.pdb.gz
19	PDB:1cnt1	0.493	0.772	2.293E-2	150	0.115	0.187	1cnt1.pdb.gz
20	PDB:3d48P	0.473	0.674	2.527E-2	165	0.115	0.170	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NEV9	2.00e-170	471	243	1.000	1.000	IL27A_HUMAN Interleukin-27 subunit alpha OS=Homo sapiens OX=9606 GN=IL27 PE=1 SV=2
2	Q8K3I6	2.14e-89	265	234	0.700	0.726	IL27A_MOUSE Interleukin-27 subunit alpha OS=Mus musculus OX=10090 GN=Il27 PE=1 SV=1
3	D3ZPW3	1.23e-80	243	234	0.605	0.628	D3ZPW3_RAT Interleukin 27 OS=Rattus norvegicus OX=10116 GN=Il27 PE=4 SV=1
4	O15403	0.38	34.3	523	0.070	0.033	MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens OX=9606 GN=SLC16A6 PE=1 SV=2
5	P53355	2.1	32.0	1430	0.103	0.017	DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=DAPK1 PE=1 SV=6
6	Q80YE7	2.4	32.0	1442	0.103	0.017	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
7	Q9UBD9	5.3	30.4	225	0.144	0.156	CLCF1_HUMAN Cardiotrophin-like cytokine factor 1 OS=Homo sapiens OX=9606 GN=CLCF1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349365

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221847	0.998	Interleukin-27 subunit beta
2	9606.ENSP00000263379	0.995	Interleukin-27 receptor subunit alpha
3	9606.ENSP00000376188	0.992	Cytokine receptor-like factor 1
4	9606.ENSP00000370698	0.963	Interleukin-6 receptor subunit beta
5	9606.ENSP00000354394	0.950	Signal transducer and activator of transcription 1-alpha/beta
6	9606.ENSP00000264657	0.943	Signal transducer and activator of transcription 3
7	9606.ENSP00000343204	0.923	Tyrosine-protein kinase JAK1
8	9606.ENSP00000376134	0.921	Signal transducer and activator of transcription 4
9	9606.ENSP00000431885	0.921	Non-receptor tyrosine-protein kinase TYK2
10	9606.ENSP00000371067	0.919	Tyrosine-protein kinase JAK2
11	9606.ENSP00000341208	0.918	Signal transducer and activator of transcription 5A
12	9606.ENSP00000315768	0.917	Signal transducer and activator of transcription 2
13	9606.ENSP00000228534	0.832	Interleukin-23 subunit alpha
14	9606.ENSP00000303231	0.645	Interleukin-12 subunit alpha
15	9606.ENSP00000470788	0.625	Interleukin-12 receptor subunit beta-1
16	9606.ENSP00000262345	0.607	Interleukin-12 receptor subunit beta-2
17	9606.ENSP00000247461	0.600	Calnexin
18	9606.ENSP00000412237	0.577	Interleukin-10
19	9606.ENSP00000385675	0.544	Interleukin-6
20	9606.ENSP00000011653	0.542	T-cell surface glycoprotein CD4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.806	signaling receptor binding
GO:0005126	0.730	cytokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0048583	0.994	regulation of response to stimulus
GO:0002682	0.994	regulation of immune system process
GO:0050865	0.991	regulation of cell activation
GO:0019222	0.988	regulation of metabolic process
GO:0001817	0.984	regulation of cytokine production
GO:0010628	0.984	positive regulation of gene expression
GO:0048522	0.969	positive regulation of cellular process
GO:0050793	0.963	regulation of developmental process
GO:0032944	0.959	regulation of mononuclear cell proliferation
GO:0050776	0.958	regulation of immune response
GO:0032649	0.957	regulation of type II interferon production
GO:0002819	0.949	regulation of adaptive immune response
GO:0051249	0.949	regulation of lymphocyte activation
GO:0051240	0.941	positive regulation of multicellular organismal process
GO:0070665	0.932	positive regulation of leukocyte proliferation
GO:2000026	0.931	regulation of multicellular organismal development
GO:0050896	0.927	response to stimulus
GO:0046634	0.911	regulation of alpha-beta T cell activation
GO:0001819	0.908	positive regulation of cytokine production
GO:1903706	0.894	regulation of hemopoiesis
GO:0002822	0.887	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0009987	0.881	cellular process
GO:0031323	0.802	regulation of cellular metabolic process
GO:0080134	0.755	regulation of response to stress
GO:0031325	0.751	positive regulation of cellular metabolic process
GO:0051716	0.745	cellular response to stimulus
GO:0080090	0.727	regulation of primary metabolic process
GO:0051171	0.727	regulation of nitrogen compound metabolic process
GO:0032729	0.718	positive regulation of type II interferon production
GO:0002684	0.712	positive regulation of immune system process
GO:0048584	0.698	positive regulation of response to stimulus
GO:0031347	0.698	regulation of defense response
GO:0051173	0.697	positive regulation of nitrogen compound metabolic process
GO:0032101	0.677	regulation of response to external stimulus
GO:0050670	0.663	regulation of lymphocyte proliferation
GO:0009605	0.619	response to external stimulus
GO:1902105	0.615	regulation of leukocyte differentiation
GO:0042129	0.597	regulation of T cell proliferation
GO:0009607	0.585	response to biotic stimulus
GO:0023052	0.579	signaling
GO:0048519	0.575	negative regulation of biological process
GO:0002696	0.541	positive regulation of leukocyte activation
GO:0051251	0.530	positive regulation of lymphocyte activation
GO:0002697	0.519	regulation of immune effector process
GO:0051707	0.516	response to other organism
GO:0010646	0.510	regulation of cell communication
GO:0007165	0.499	signal transduction
GO:0023051	0.478	regulation of signaling
GO:1903037	0.464	regulation of leukocyte cell-cell adhesion
GO:0009966	0.463	regulation of signal transduction
GO:0022409	0.463	positive regulation of cell-cell adhesion
GO:0001932	0.460	regulation of protein phosphorylation
GO:0031401	0.449	positive regulation of protein modification process
GO:0048523	0.446	negative regulation of cellular process
GO:1903039	0.444	positive regulation of leukocyte cell-cell adhesion
GO:0051094	0.430	positive regulation of developmental process
GO:0045619	0.429	regulation of lymphocyte differentiation
GO:0001934	0.409	positive regulation of protein phosphorylation
GO:0032502	0.366	developmental process
GO:0002831	0.361	regulation of response to biotic stimulus
GO:0010033	0.356	response to organic substance
GO:0048856	0.339	anatomical structure development
GO:0007166	0.336	cell surface receptor signaling pathway
GO:0050731	0.330	positive regulation of peptidyl-tyrosine phosphorylation
GO:0032946	0.324	positive regulation of mononuclear cell proliferation
GO:0045580	0.324	regulation of T cell differentiation
GO:0050688	0.316	regulation of defense response to virus
GO:0050778	0.316	positive regulation of immune response
GO:2000514	0.309	regulation of CD4-positive, alpha-beta T cell activation
GO:0002376	0.308	immune system process
GO:0046637	0.305	regulation of alpha-beta T cell differentiation
GO:0050691	0.303	regulation of defense response to virus by host

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0005829	0.997	cytosol
GO:0070013	0.993	intracellular organelle lumen
GO:0012505	0.992	endomembrane system
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0071944	0.730	cell periphery
GO:0005783	0.672	endoplasmic reticulum
GO:0005788	0.628	endoplasmic reticulum lumen
GO:0005615	0.527	extracellular space
GO:0031981	0.455	nuclear lumen
GO:0016020	0.452	membrane
GO:0005886	0.440	plasma membrane
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]