StarFunc result for job id Q8NEY1

User Input

>input (1877 residues)
MLGSSVKSVQPEVELSSGGGDEGADEPRGAGRKAAAADGRGMLPKRAKAPGGGGGMAKAS
AAELKVFKSGSVDSRVPGGPPASNLRKQKSLTNLSFLTDSEKKLQLYEPEWSDDMAKAPK
GLGKVGSKGREAPLMSKTLSKSEHSLFQAKGSPAGGAKTPLAPLAPNLGKPSRIPRGPYA
EVKPLSKAPEAAVSEDGKSDDELLSSKAKAQKSSGPVPSAKGQEERAFLKVDPELVVTVL
GDLEQLLFSQMLDPESQRKRTVQNVLDLRQNLEETMSSLRGSQVTHSSLEMTCYDSDDAN
PRSVSSLSNRSSPLSWRYGQSSPRLQAGDAPSVGGSCRSEGTPAWYMHGERAHYSHTMPM
RSPSKLSHISRLELVESLDSDEVDLKSGYMSDSDLMGKTMTEDDDITTGWDESSSISSGL
SDASDNLSSEEFNASSSLNSLPSTPTASRRNSTIVLRTDSEKRSLAESGLSWFSESEEKA
PKKLEYDSGSLKMEPGTSKWRRERPESCDDSSKGGELKKPISLGHPGSLKKGKTPPVAVT
SPITHTAQSALKVAGKPEGKATDKGKLAVKNTGLQRSSSDAGRDRLSDAKKPPSGIARPS
TSGSFGYKKPPPATGTATVMQTGGSATLSKIQKSSGIPVKPVNGRKTSLDVSNSAEPGFL
APGARSNIQYRSLPRPAKSSSMSVTGGRGGPRPVSSSIDPSLLSTKQGGLTPSRLKEPTK
VASGRTTPAPVNQTDREKEKAKAKAVALDSDNISLKSIGSPESTPKNQASHPTATKLAEL
PPTPLRATAKSFVKPPSLANLDKVNSNSLDLPSSSDTTHASKVPDLHATSSASGGPLPSC
FTPSPAPILNINSASFSQGLELMSGFSVPKETRMYPKLSGLHRSMESLQMPMSLPSAFPS
STPVPTPPAPPAAPTEEETEELTWSGSPRAGQLDSNQRDRNTLPKKGLRYQLQSQEETKE
RRHSHTIGGLPESDDQSELPSPPALPMSLSAKGQLTNIVSPTAATTPRITRSNSIPTHEA
AFELYSGSQMGSTLSLAERPKGMIRSGSFRDPTDDVHGSVLSLASSASSTYSSAEERMQS
EQIRKLRRELESSQEKVATLTSQLSANANLVAAFEQSLVNMTSRLRHLAETAEEKDTELL
DLRETIDFLKKKNSEAQAVIQGALNASETTPKELRIKRQNSSDSISSLNSITSHSSIGSS
KDADAKKKKKKSWVYELRSSFNKAFSIKKGPKSASSYSDIEEIATPDSSAPSSPKLQHGS
TETASPSIKSSTSSSVGTDVTEGPAHPAPHTRLFHANEEEEPEKKEVSELRSELWEKEMK
LTDIRLEALNSAHQLDQLRETMHNMQLEVDLLKAENDRLKVAPGPSSGSTPGQVPGSSAL
SSPRRSLGLALTHSFGPSLADTDLSPMDGISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQ
EFFLGCSKVSGKVDWKMLDEAVFQVFKDYISKMDPASTLGLSTESIHGYSISHVKRVLDA
EPPEMPPCRRGVNNISVSLKGLKEKCVDSLVFETLIPKPMMQHYISLLLKHRRLVLSGPS
GTGKTYLTNRLAEYLVERSGREVTEGIVSTFNMHQQSCKDLQLYLSNLANQIDRETGIGD
VPLVILLDDLSEAGSISELVNGALTCKYHKCPYIIGTTNQPVKMTPNHGLHLSFRMLTFS
NNVEPANGFLVRYLRRKLVESDSDINANKEELLRVLDWVPKLWYHLHTFLEKHSTSDFLI
GPCFFLSCPIGIEDFRTWFIDLWNNSIIPYLQEGAKDGIKVHGQKAAWEDPVEWVRDTLP
WPSAQQDQSKLYHLPPPTVGPHSIASPPEDRTVKDSTPSSLDSDPLMAMLLKLQEAANYI
ESPDRETILDPNLQATL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NEY1	1.000	1.000	0.000	1877	1.000	1.000	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
2	AFDB:Q80TN7	0.223	0.180	1.031E-92	2359	0.413	0.329	Q80TN7.pdb.gz	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
3	AFDB:Q8IVL0	0.225	0.180	5.512E-91	2385	0.422	0.332	Q8IVL0.pdb.gz	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
4	AFDB:E9Q842	0.229	0.179	1.202E-89	2432	0.417	0.322	E9Q842.pdb.gz	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
5	AFDB:Q8IVL1	0.224	0.172	3.653E-87	2488	0.413	0.311	Q8IVL1.pdb.gz	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
6	AFDB:F1LR12	0.237	0.188	4.766E-84	2425	0.410	0.317	F1LR12.pdb.gz	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3
7	AFDB:Q5TZ18	0.198	0.165	7.322E-80	2269	0.391	0.323	Q5TZ18.pdb.gz	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
8	AFDB:Q9VIQ9	0.209	0.180	3.871E-52	2197	0.265	0.227	Q9VIQ9.pdb.gz	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
9	AFDB:E9PNV5	0.060	0.130	2.224E-18	815	0.167	0.385	E9PNV5.pdb.gz	E9PNV5_HUMAN Neuron navigator 2 (Fragment) OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=8
10	PDB:7tfhB	0.089	0.375	3.499E-6	320	0.023	0.138	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
11	PDB:6vvoB	0.083	0.356	9.072E-6	316	0.019	0.111	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
12	PDB:6ut6D	0.108	0.554	9.595E-6	292	0.030	0.192	6ut6D.pdb.gz	Structural asymmetry governs the assembly and GTPase activity of McrBC restriction complexes
13	PDB:7pxcE	0.091	0.275	1.420E-5	483	0.029	0.114	7pxcE.pdb.gz	Structural basis of prokaryotic ubiquitin-like protein engagement and translocation by the mycobacterial Mpa-proteasome complex.
14	PDB:7steA	0.087	0.301	1.589E-5	468	0.027	0.109	7steA.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
15	PDB:6opcB	0.078	0.164	1.988E-5	741	0.034	0.086	6opcB.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
16	PDB:6opcF	0.066	0.160	3.482E-5	681	0.022	0.062	6opcF.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
17	PDB:5vqaA	0.086	0.337	4.357E-5	368	0.022	0.111	5vqaA.pdb.gz	The AAA+ ATPase TRIP13 remodels HORMA domains through N-terminal engagement and unfolding.
18	PDB:1sxjE	0.080	0.321	5.766E-5	317	0.021	0.123	1sxjE.pdb.gz	Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
19	PDB:8dr0D	0.087	0.349	6.450E-5	344	0.023	0.125	8dr0D.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
20	AFDB:P56786	0.078	0.067	1.329E-4	2294	0.142	0.116	P56786.pdb.gz	YCF2_ARATH Protein Ycf2 OS=Arabidopsis thaliana OX=3702 GN=ycf2-A PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K833	0.0	824	2356	0.254	0.202	A0A0G2K833_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=2
2	A0A8I5ZQM9	0.0	833	2366	0.255	0.202	A0A8I5ZQM9_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=1
3	A0A8I6A8E6	0.0	1066	2319	0.387	0.313	A0A8I6A8E6_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=1
4	E9Q842	0.0	830	2432	0.254	0.196	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
5	F1LR12	0.0	996	2392	0.370	0.291	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3
6	Q5TZ18	0.0	929	2269	0.373	0.309	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
7	Q80TN7	0.0	1157	2359	0.403	0.321	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
8	Q8CH77	0.0	3430	1875	0.962	0.963	NAV1_MOUSE Neuron navigator 1 OS=Mus musculus OX=10090 GN=Nav1 PE=1 SV=2
9	Q8IVL0	0.0	1152	2385	0.407	0.320	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
10	Q8NEY1	0.0	3806	1877	1.000	1.000	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
11	V9GX91	0.0	831	2432	0.254	0.196	V9GX91_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
12	V9GXT3	0.0	830	2371	0.254	0.201	V9GXT3_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
13	Q9VIQ9	5.17e-99	358	2197	0.092	0.079	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
14	E9PNV5	2.74e-92	322	815	0.166	0.383	E9PNV5_HUMAN Neuron navigator 2 (Fragment) OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=8
15	Q8IVL1	1.26e-78	292	2488	0.122	0.092	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
16	Q7YSI9	8.95e-55	214	1654	0.109	0.123	UNC53_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=1 SV=1
17	C8JQR2	1.16e-54	213	1346	0.109	0.152	C8JQR2_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=3 SV=1
18	G5EBX1	3.66e-53	208	1613	0.078	0.091	G5EBX1_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=3 SV=1
19	G5EEU6	4.67e-53	208	1542	0.078	0.095	G5EEU6_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=3 SV=1
20	Q6ZPE7	1.15e-34	147	858	0.043	0.094	Q6ZPE7_MOUSE MKIAA3015 protein (Fragment) OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	13	17.6	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	1.3e+02	14.0	AAA domain
3	PF13191 AAA_16	2.3	20.0	AAA ATPase domain
4	PF13238 AAA_18	2e+02	14.0	AAA domain
5	PF13245 AAA_19	30	16.3	AAA domain
6	PF13401 AAA_22	17	17.2	AAA domain
7	PF13521 AAA_28	11	17.6	AAA domain
8	PF13604 AAA_30	3.1e+02	12.5	AAA domain
9	PF07728 AAA_5	1e+02	14.3	AAA domain (dynein-related subfamily)
10	PF12775 AAA_7	5.6e+02	11.4	P-loop containing dynein motor region
11	PF10814 CwsA	3e+02	13.1	Cell wall synthesis protein CwsA
12	PF01078 Mg_chelatase	1.3e+02	13.3	Magnesium chelatase, subunit ChlI
13	PF05729 NACHT	1.6e+02	13.6	NACHT domain
14	PF02562 PhoH	42	15.1	PhoH-like protein
15	PF00910 RNA_helicase	57	15.5	RNA helicase
16	PF03193 RsgA_GTPase	1.4e+02	13.7	RsgA GTPase
17	PF00437 T2SSE	1.6e+02	12.7	Type II/IV secretion system protein
18	PF06309 Torsin	2.2e+02	13.3	Torsin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356265

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396320	0.871	Sodium channel protein type 4 subunit alpha
2	9606.ENSP00000410257	0.849	Sodium channel protein type 5 subunit alpha
3	9606.ENSP00000280772	0.830	Ankyrin-3
4	9606.ENSP00000386306	0.825	Sodium channel protein type 9 subunit alpha
5	9606.ENSP00000364586	0.770	Sodium channel protein type 2 subunit alpha
6	9606.ENSP00000346534	0.767	Sodium channel protein type 8 subunit alpha
7	9606.ENSP00000303540	0.764	Sodium channel protein type 1 subunit alpha
8	9606.ENSP00000390600	0.753	Sodium channel protein type 10 subunit alpha
9	9606.ENSP00000283254	0.744	Sodium channel protein type 3 subunit alpha
10	9606.ENSP00000307599	0.733	Sodium channel protein type 11 subunit alpha
11	9606.ENSP00000262186	0.660	Potassium voltage-gated channel subfamily H member 2
12	9606.ENSP00000278947	0.648	Sodium channel subunit beta-2
13	9606.ENSP00000360806	0.632	Potassium voltage-gated channel subfamily B member 1
14	9606.ENSP00000332979	0.606	Beta-secretase 2
15	9606.ENSP00000434552	0.594	Mastermind-like protein 2
16	9606.ENSP00000345494	0.572	Phospholipid scramblase 1
17	9606.ENSP00000322460	0.559	Sodium channel subunit beta-4
18	9606.ENSP00000274629	0.556	Calcium-activated potassium channel subunit beta-1
19	9606.ENSP00000318585	0.551	Beta-secretase 1
20	9606.ENSP00000266376	0.539	Voltage-dependent L-type calcium channel subunit alpha-1C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.990	multicellular organismal process
GO:0009987	0.985	cellular process
GO:0032502	0.975	developmental process
GO:0016043	0.973	cellular component organization
GO:0048856	0.946	anatomical structure development
GO:0007275	0.941	multicellular organism development
GO:0000226	0.900	microtubule cytoskeleton organization
GO:0048731	0.890	system development
GO:0065007	0.848	biological regulation
GO:0007399	0.832	nervous system development
GO:0001578	0.817	microtubule bundle formation
GO:0050789	0.758	regulation of biological process
GO:0048870	0.694	cell motility
GO:0050794	0.594	regulation of cellular process
GO:0050896	0.312	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0071944	0.935	cell periphery
GO:0016020	0.927	membrane
GO:0042995	0.924	cell projection
GO:0043232	0.878	intracellular non-membrane-bounded organelle
GO:0120025	0.847	plasma membrane bounded cell projection
GO:0005886	0.827	plasma membrane
GO:0032991	0.810	protein-containing complex
GO:0043005	0.780	neuron projection
GO:0005737	0.763	cytoplasm
GO:0005856	0.732	cytoskeleton
GO:0043231	0.723	intracellular membrane-bounded organelle
GO:0030424	0.687	axon
GO:0015630	0.683	microtubule cytoskeleton
GO:0043194	0.594	axon initial segment
GO:0005634	0.429	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]