StarFunc result for job id Q8NEY8

User Input

>input (458 residues)
MWSEGRYEYERIPRERAPPRSHPSDGYNRLVNIVPKKPPLLDRPGEGSYNRYYSHVDYRD
YDEGRSFSHDRRSGPPHRGDESGYRWTRDDHSASRQPEYRDMRDGFRRKSFYSSHYARER
SPYKRDNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSYSFHQSQHRKSVRPGASYK
RQNEGNPERDKERPVQSLKTSRDTSPSSGSAVSSSKVLDKPSRLTEKELAEAASKWAAEK
LEKSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKE
IEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIESAGQTWQQVPPVRNTEMD
HDGTPENEGEETAQSAPQPPQAPQPLQPRKKRVRRTTQLRRTTGAPDITWGMLKKTTQEA
ERILLRTQTPFTPENLFLAMLSVVHCNSRKDVKPENKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NEY8	0.999	0.999	3.349E-64	458	1.000	1.000	Q8NEY8.pdb.gz	PPHLN_HUMAN Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=2
2	AFDB:F8WF16	0.197	0.271	2.005E-29	303	0.596	0.901	F8WF16.pdb.gz	F8WF16_HUMAN Periphilin 1 OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=1
3	AFDB:Q9GYQ9	0.119	0.078	1.647E-3	796	0.166	0.095	Q9GYQ9.pdb.gz	Q9GYQ9_CAEEL CCR4-NOT transcription complex subunit 4 OS=Caenorhabditis elegans OX=6239 GN=ntl-4 PE=1 SV=2
4	AFDB:Q95XN0	0.077	0.055	3.230E-3	728	0.142	0.089	Q95XN0.pdb.gz	Q95XN0_CAEEL LIN-65L OS=Caenorhabditis elegans OX=6239 GN=lin-65 PE=1 SV=2
5	AFDB:F4I420	0.108	0.046	1.329E-2	1294	0.157	0.056	F4I420.pdb.gz	F4I420_ARATH Eukaryotic translation initiation factor 5B OS=Arabidopsis thaliana OX=3702 GN=EIF5B1 PE=1 SV=1
6	AFDB:Q5SZL2	0.071	0.048	1.990E-2	805	0.140	0.080	Q5SZL2.pdb.gz	CE85L_HUMAN Centrosomal protein of 85 kDa-like OS=Homo sapiens OX=9606 GN=CEP85L PE=1 SV=1
7	AFDB:Q9UPN4	0.073	0.038	2.606E-2	1083	0.155	0.066	Q9UPN4.pdb.gz	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3
8	AFDB:A0A1D9BZF0	0.075	0.070	2.787E-2	507	0.153	0.138	A0A1D9BZF0.pdb.gz	GCNA_MOUSE Germ cell nuclear acidic protein OS=Mus musculus OX=10090 GN=Gcna PE=1 SV=1
9	AFDB:U3JAG9	0.074	0.032	3.411E-2	1113	0.166	0.068	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
10	AFDB:Q9C7E7	0.067	0.052	4.175E-2	786	0.162	0.094	Q9C7E7.pdb.gz	RDM16_ARATH Protein RDM16 OS=Arabidopsis thaliana OX=3702 GN=RDM16 PE=2 SV=1
11	PDB:7ajuCL	0.084	0.050	2.586	808	0.059	0.033	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:1oqfA	0.048	0.072	2.766	290	0.009	0.014	1oqfA.pdb.gz
13	PDB:1yhdA	0.083	0.339	3.165	92	0.015	0.076	1yhdA.pdb.gz
14	PDB:3b0dC	0.070	0.325	4.433	75	0.020	0.120	3b0dC.pdb.gz
15	PDB:7ajtCL	0.101	0.065	4.741	781	0.066	0.038	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:6z3mP	0.061	0.257	5.425	76	0.011	0.066	6z3mP.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
17	PDB:1ui0A	0.058	0.120	5.803	192	0.020	0.047	1ui0A.pdb.gz	Crystal Structure of a Family 4 Uracil-DNA Glycosylase from Thermus thermophilus HB8
18	PDB:7d63RJ	0.100	0.062	5.803	796	0.052	0.030	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
19	PDB:2h8kA	0.075	0.125	6.640	245	0.022	0.041	2h8kA.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
20	PDB:4rtaB	0.071	0.342	6.640	71	0.015	0.099	4rtaB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7Z8L1	0.0	552	340	0.659	0.888	B7Z8L1_HUMAN Periphilin 1 OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=1
2	F8W0Q9	0.0	693	385	0.745	0.886	F8W0Q9_HUMAN Periphilin 1 OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=1
3	F8W6A0	0.0	558	363	0.723	0.912	F8W6A0_HUMAN Periphilin 1 OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=1
4	Q8NEY8	0.0	939	458	1.000	1.000	PPHLN_HUMAN Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=2
5	F8WF16	4.32e-150	431	303	0.550	0.832	F8WF16_HUMAN Periphilin 1 OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=1
6	F8VWU8	2.39e-117	342	168	0.367	1.000	F8VWU8_HUMAN Periphilin 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=1
7	F8VPY7	4.00e-107	316	161	0.336	0.957	F8VPY7_HUMAN Periphilin 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=1
8	Q96A10	2.90e-07	50.1	74	0.057	0.351	Q96A10_HUMAN Endogenous retrovirus group K3 member 1 OS=Homo sapiens OX=9606 GN=ERVK3-1 PE=1 SV=1
9	Q69383	1.2	32.0	105	0.044	0.190	REC6_HUMAN Endogenous retrovirus group K member 6 Rec protein OS=Homo sapiens OX=9606 GN=ERVK-6 PE=1 SV=1
10	Q9NVF9	5.3	32.0	386	0.037	0.044	EKI2_HUMAN Ethanolamine kinase 2 OS=Homo sapiens OX=9606 GN=ETNK2 PE=1 SV=3
11	A0A0G2JVQ2	7.9	31.2	411	0.037	0.041	A0A0G2JVQ2_RAT LIM domain binding 1 OS=Rattus norvegicus OX=10116 GN=Ldb1 PE=1 SV=1
12	F2Z5G6	7.9	31.2	411	0.037	0.041	F2Z5G6_PIG LIM domain binding 1 OS=Sus scrofa OX=9823 GN=LDB1 PE=3 SV=4
13	P70662	7.9	31.2	411	0.037	0.041	LDB1_MOUSE LIM domain-binding protein 1 OS=Mus musculus OX=10090 GN=Ldb1 PE=1 SV=2
14	Q86U70	7.9	31.2	411	0.037	0.041	LDB1_HUMAN LIM domain-binding protein 1 OS=Homo sapiens OX=9606 GN=LDB1 PE=1 SV=2
15	A0A8I6G409	8.3	31.2	412	0.037	0.041	A0A8I6G409_RAT LIM domain binding 1 OS=Rattus norvegicus OX=10116 GN=Ldb1 PE=1 SV=1
16	Q57XU8	8.7	31.2	613	0.037	0.028	Q57XU8_TRYB2 RNA binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.20 PE=4 SV=1
17	B2RYF3	9.0	31.2	467	0.037	0.036	B2RYF3_RAT Ldb1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ldb1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15695 HERV-K_REC	0.85	21.0	Rec (regulator of expression encoded by corf) of HERV-K-113
2	PF11488 Lge1	1.5e-17	74.9	Transcriptional regulatory protein LGE1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378935

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417509	0.917	Protein TASOR
2	9606.ENSP00000355388	0.895	M-phase phosphoprotein 8
3	9606.ENSP00000340510	0.822	Periplakin
4	9606.ENSP00000266529	0.795	Zinc finger CCHC-type and RNA binding motif containing 1
5	9606.ENSP00000415899	0.765	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs
6	9606.ENSP00000266534	0.760	Transmembrane protein 117
7	9606.ENSP00000449428	0.732	Twinfilin-1
8	9606.ENSP00000346955	0.731	S-adenosylmethionine mitochondrial carrier protein
9	9606.ENSP00000376849	0.731	Caspase-5
10	9606.ENSP00000381666	0.731	Glucoside xylosyltransferase 1
11	9606.ENSP00000295899	0.721	THO complex subunit 7 homolog
12	9606.ENSP00000280871	0.694	Proton myo-inositol cotransporter
13	9606.ENSP00000357345	0.683	Dual specificity protein kinase CLK2
14	9606.ENSP00000418695	0.682	Proteasome 26S subunit, non-ATPase 6
15	9606.ENSP00000465617	0.653	Immediate early response gene 2 protein
16	9606.ENSP00000355330	0.647	Protein-glutamine gamma-glutamyltransferase 2
17	9606.ENSP00000261368	0.623	Synphilin-1
18	9606.ENSP00000439585	0.613	Ataxin-7
19	9606.ENSP00000215862	0.606	MORC family CW-type zinc finger protein 2
20	9606.ENSP00000328004	0.566	YY1 associated factor 2, isoform CRA_d

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0010605	0.964	negative regulation of macromolecule metabolic process
GO:0016043	0.945	cellular component organization
GO:0048522	0.923	positive regulation of cellular process
GO:0033043	0.887	regulation of organelle organization
GO:0051179	0.880	localization
GO:0044087	0.880	regulation of cellular component biogenesis
GO:0010468	0.879	regulation of gene expression
GO:0051641	0.827	cellular localization
GO:0033044	0.818	regulation of chromosome organization
GO:1902275	0.815	regulation of chromatin organization
GO:0051130	0.811	positive regulation of cellular component organization
GO:0010638	0.765	positive regulation of organelle organization
GO:2001252	0.761	positive regulation of chromosome organization
GO:0040029	0.757	epigenetic regulation of gene expression
GO:0120261	0.755	regulation of heterochromatin organization
GO:0045814	0.753	negative regulation of gene expression, epigenetic
GO:0033036	0.747	macromolecule localization
GO:0034502	0.737	protein localization to chromosome
GO:0031445	0.728	regulation of heterochromatin formation
GO:0071168	0.645	protein localization to chromatin
GO:0044089	0.420	positive regulation of cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0012505	0.993	endomembrane system
GO:0005829	0.987	cytosol
GO:0005794	0.973	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]