StarFunc result for job id Q8NEZ3

User Input

>input (1342 residues)
MKRIFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAM
DWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKGN
LLIYNHQTSRKIPVLGKHTKRITCGCWNAENLLALGGEDKMITVSNQEGDTIRQTQVRSE
PSNMQFFLMKMDDRTSAAESMISVVLGKKTLFFLNLNEPDNPADLEFQQDFGNIVCYNWY
GDGRIMIGFSCGHFVVISTHTGELGQEIFQARNHKDNLTSIAVSQTLNKVATCGDNCIKI
QDLVDLKDMYVILNLDEENKGLGTLSWTDDGQLLALSTQRGSLHVFLTKLPILGDACSTR
IAYLTSLLEVTVANPVEGELPITVSVDVEPNFVAVGLYHLAVGMNNRAWFYVLGENAVKK
LKDMEYLGTVASICLHSDYAAALFEGKVQLHLIESEILDAQEERETRLFPAVDDKCRILC
HALTSDFLIYGTDTGVVQYFYIEDWQFVNDYRHPVSVKKIFPDPNGTRLVFIDEKSDGFV
YCPVNDATYEIPDFSPTIKGVLWENWPMDKGVFIAYDDDKVYTYVFHKDTIQGAKVILAG
STKVPFAHKPLLLYNGELTCQTQSGKVNNIYLSTHGFLSNLKDTGPDELRPMLAQNLMLK
RFSDAWEMCRILNDEAAWNELARACLHHMEVEFAIRVYRRIGNVGIVMSLEQIKGIEDYN
LLAGHLAMFTNDYNLAQDLYLASSCPIAALEMRRDLQHWDSALQLAKHLAPDQIPFISKE
YAIQLEFAGDYVNALAHYEKGITGDNKEHDEACLAGVAQMSIRMGDIRRGVNQALKHPSR
VLKRDCGAILENMKQFSEAAQLYEKGLYYDKAASVYIRSKNWAKVGDLLPHVSSPKIHLQ
YAKAKEADGRYKEAVVAYENAKQWQSVIRIYLDHLNNPEKAVNIVRETQSLDGAKMVARF
FLQLGDYGSAIQFLVMSKCNNEAFTLAQQHNKMEIYADIIGSEDTTNEDYQSIALYFEGE
KRYLQAGKFFLLCGQYSRALKHFLKCPSSEDNVAIEMAIETVGQAKDELLTNQLIDHLLG
ENDGMPKDAKYLFRLYMALKQYREAAQTAIIIAREEQSAGNYRNAHDVLFSMYAELKSQK
IKIPSEMATNLMILHSYILVKIHVKNGDHMKGARMLIRVANNISKFPSHIVPILTSTVIE
CHRAGLKNSAFSFAAMLMRPEYRSKIDAKYKKKIEGMVRRPDISEIEEATTPCPFCKFLL
PECELLCPGCKNSIPYCIATGRHMLKDDWTVCPHCDFPALYSELKIMLNTESTCPMCSER
LNAAQLKKISDCTQYLRTEEEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8RPA6	0.611	0.598	0.000	1372	0.764	0.747	A0A2R8RPA6.pdb.gz
2	AFDB:A1ZBM3	0.536	0.527	0.000	1366	0.414	0.406	A1ZBM3.pdb.gz	A1ZBM3_DROME Outer segment 6 OS=Drosophila melanogaster OX=7227 GN=Oseg6 PE=4 SV=1
3	AFDB:G5ECZ4	0.747	0.729	0.000	1383	0.394	0.383	G5ECZ4.pdb.gz	DYF2_CAEEL WD repeat-containing protein dyf-2 OS=Caenorhabditis elegans OX=6239 GN=dyf-2 PE=1 SV=1
4	AFDB:Q3UGF1	0.628	0.629	0.000	1341	0.893	0.893	Q3UGF1.pdb.gz	WDR19_MOUSE WD repeat-containing protein 19 OS=Mus musculus OX=10090 GN=Wdr19 PE=1 SV=1
5	AFDB:Q8NEZ3	1.000	1.000	0.000	1342	1.000	1.000	Q8NEZ3.pdb.gz	WDR19_HUMAN WD repeat-containing protein 19 OS=Homo sapiens OX=9606 GN=WDR19 PE=1 SV=2
6	AFDB:Q387M5	0.539	0.534	2.468E-90	1356	0.320	0.317	Q387M5.pdb.gz	Q387M5_TRYB2 WD repeat-containing protein 19 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0880 PE=4 SV=1
7	AFDB:Q96RY7	0.364	0.339	1.084E-36	1462	0.157	0.144	Q96RY7.pdb.gz	IF140_HUMAN Intraflagellar transport protein 140 homolog OS=Homo sapiens OX=9606 GN=IFT140 PE=1 SV=1
8	AFDB:Q9W097	0.219	0.237	3.397E-36	1205	0.142	0.158	Q9W097.pdb.gz	Q9W097_DROME LD29485p OS=Drosophila melanogaster OX=7227 GN=Oseg4 PE=2 SV=1
9	AFDB:E9PY46	0.327	0.304	4.397E-36	1464	0.149	0.137	E9PY46.pdb.gz	IF140_MOUSE Intraflagellar transport protein 140 homolog OS=Mus musculus OX=10090 GN=Ift140 PE=1 SV=1
10	AFDB:Q57ZX9	0.215	0.227	4.653E-35	1260	0.136	0.145	Q57ZX9.pdb.gz	Q57ZX9_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.80 PE=4 SV=1
11	PDB:7mqaLQ	0.192	0.294	1.300E-18	830	0.083	0.135	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mq8LR	0.190	0.315	2.260E-18	773	0.077	0.135	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:5a1vK	0.191	0.222	2.525E-18	1126	0.118	0.140	5a1vK.pdb.gz
14	PDB:6qk7A	0.240	0.270	7.086E-18	1161	0.113	0.131	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
15	PDB:7ajuUL	0.143	0.221	3.157E-16	779	0.074	0.127	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:5nzrC	0.191	0.285	3.275E-16	843	0.077	0.123	5nzrC.pdb.gz
17	PDB:5wyjBE	0.191	0.314	3.796E-16	753	0.068	0.121	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
18	PDB:7mq8LT	0.182	0.270	5.097E-16	869	0.086	0.132	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:3sfzA	0.186	0.216	6.598E-16	1133	0.056	0.066	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
20	PDB:6lqsB1	0.192	0.302	1.329E-15	806	0.087	0.145	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1ZBM3	0.0	1088	1366	0.413	0.406	A1ZBM3_DROME Outer segment 6 OS=Drosophila melanogaster OX=7227 GN=Oseg6 PE=4 SV=1
2	G5ECZ4	0.0	1027	1383	0.396	0.384	DYF2_CAEEL WD repeat-containing protein dyf-2 OS=Caenorhabditis elegans OX=6239 GN=dyf-2 PE=1 SV=1
3	Q387M5	0.0	713	1356	0.328	0.324	Q387M5_TRYB2 WD repeat-containing protein 19 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0880 PE=4 SV=1
4	Q3UGF1	0.0	2573	1341	0.896	0.896	WDR19_MOUSE WD repeat-containing protein 19 OS=Mus musculus OX=10090 GN=Wdr19 PE=1 SV=1
5	Q8MZ45	0.0	686	845	0.259	0.412	Q8MZ45_DROME LD22578p OS=Drosophila melanogaster OX=7227 GN=Oseg6 PE=2 SV=1
6	Q8NEZ3	0.0	2810	1342	1.000	1.000	WDR19_HUMAN WD repeat-containing protein 19 OS=Homo sapiens OX=9606 GN=WDR19 PE=1 SV=2
7	Q68K27	9.86e-12	72.4	1384	0.076	0.074	Q68K27_CHLRE Intraflagellar transport particle protein 140 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT140 PE=1 SV=1
8	O94423	1.80e-09	63.9	421	0.028	0.090	MFR1_SCHPO Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mfr1 PE=1 SV=1
9	Q38CC3	2.83e-09	64.3	1747	0.080	0.062	Q38CC3_TRYB2 Intraflagellar transport protein 172 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6920 PE=4 SV=1
10	B1WCA1	3.14e-08	60.5	493	0.025	0.067	B1WCA1_RAT Fizzy and cell division cycle 20 related 1 OS=Rattus norvegicus OX=10116 GN=Fzr1 PE=1 SV=1
11	Q9UM11	3.73e-08	60.1	496	0.025	0.067	FZR1_HUMAN Fizzy-related protein homolog OS=Homo sapiens OX=9606 GN=FZR1 PE=1 SV=2
12	Q09649	4.57e-08	60.1	702	0.026	0.050	Q09649_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fzr-1 PE=1 SV=1
13	Q9R1K5	9.01e-08	58.9	493	0.024	0.065	FZR1_MOUSE Fizzy-related protein homolog OS=Mus musculus OX=10090 GN=Fzr1 PE=1 SV=1
14	Q5H7B9	9.08e-08	58.9	493	0.024	0.065	Q5H7B9_PIG FZR1 protein OS=Sus scrofa OX=9823 GN=FZR1 PE=2 SV=1
15	Q8LPL5	9.27e-08	58.9	481	0.023	0.064	FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana OX=3702 GN=FZR3 PE=1 SV=1
16	Q5ACY4	2.84e-06	54.3	597	0.027	0.060	Q5ACY4_CANAL Cdh1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDH1 PE=3 SV=1
17	Q38B65	2.96e-06	54.3	1242	0.047	0.051	Q38B65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1660 PE=4 SV=1
18	Q8L3Z8	8.08e-06	52.4	483	0.025	0.068	FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana OX=3702 GN=FZR2 PE=1 SV=1
19	Q22830	8.56e-06	53.1	1737	0.066	0.051	OSM1_CAEEL Intraflagellar transport protein osm-1 OS=Caenorhabditis elegans OX=6239 GN=osm-1 PE=1 SV=4
20	O13286	8.72e-06	52.4	556	0.025	0.059	SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srw1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	34	16.1	Anaphase-promoting complex, cyclosome, subunit 3
2	PF12894 ANAPC4_WD40	6.1e-06	37.8	Anaphase-promoting complex subunit 4 WD40 domain
3	PF00637 Clathrin	4.1e-07	41.4	Region in Clathrin and VPS
4	PF04053 Coatomer_WDAD	0.0004	31.2	Coatomer WD associated region
5	PF12773 DZR	7.9e+02	11.5	Double zinc ribbon
6	PF08662 eIF2A	14	17.0	Eukaryotic translation initiation factor eIF2A
7	PF04762 IKI3	85	12.6	IKI3 family
8	PF20426 NBCH_WD40	85	13.4	Neurobeachin beta propeller domain
9	PF14938 SNAP	4.7e+02	11.6	Soluble NSF attachment protein, SNAP
10	PF00515 TPR_1	5.7e+02	11.8	Tetratricopeptide repeat
11	PF13428 TPR_14	5.4e+02	12.9	Tetratricopeptide repeat
12	PF14559 TPR_19	1.1	21.0	Tetratricopeptide repeat
13	PF13181 TPR_8	7.1e+02	11.9	Tetratricopeptide repeat
14	PF00400 WD40	0.88	21.7	WD domain, G-beta repeat
15	PF15911 WD40_3	1.5e-24	97.0	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382717

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000406012	0.999	Intraflagellar transport protein 140 homolog
2	9606.ENSP00000314444	0.997	WD repeat-containing protein 35
3	9606.ENSP00000243344	0.996	Tetratricopeptide repeat protein 21B
4	9606.ENSP00000296266	0.995	Intraflagellar transport protein 122 homolog
5	9606.ENSP00000238628	0.994	Intraflagellar transport proteins
6	9606.ENSP00000312778	0.980	Intraflagellar transport protein 80 homolog
7	9606.ENSP00000260570	0.970	Intraflagellar transport protein 172 homolog
8	9606.ENSP00000323580	0.969	Intraflagellar transport protein 88 homolog
9	9606.ENSP00000393541	0.959	Intraflagellar transport protein 27 homolog
10	9606.ENSP00000362121	0.958	Intraflagellar transport protein 52 homolog
11	9606.ENSP00000419279	0.956	Intraflagellar transport protein 56
12	9606.ENSP00000381167	0.952	Cytoplasmic dynein 2 heavy chain 1
13	9606.ENSP00000264020	0.951	Intraflagellar transport proteins
14	9606.ENSP00000264538	0.943	Intraflagellar transport protein 57 homolog
15	9606.ENSP00000474032	0.942	Cytoplasmic dynein 2 light intermediate chain 1
16	9606.ENSP00000362424	0.938	TRAF3-interacting protein 1
17	9606.ENSP00000380321	0.934	Tubby-related protein 3
18	9606.ENSP00000242591	0.929	Intraflagellar transport protein 81 homolog
19	9606.ENSP00000320359	0.928	Intraflagellar transport protein 22 homolog
20	9606.ENSP00000404122	0.924	Intraflagellar transport protein 74 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0016043	0.990	cellular component organization
GO:0006996	0.978	organelle organization
GO:0022607	0.977	cellular component assembly
GO:0044782	0.952	cilium organization
GO:0051179	0.885	localization
GO:0060271	0.809	cilium assembly
GO:0051641	0.770	cellular localization
GO:0008104	0.618	protein localization
GO:0065007	0.566	biological regulation
GO:0050789	0.562	regulation of biological process
GO:0050794	0.505	regulation of cellular process
GO:0007018	0.491	microtubule-based movement
GO:0099111	0.491	microtubule-based transport
GO:0010970	0.408	transport along microtubule
GO:0042073	0.361	intraciliary transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030990	0.999	intraciliary transport particle
GO:0005929	0.999	cilium
GO:0043232	0.954	intracellular non-membrane-bounded organelle
GO:0005856	0.925	cytoskeleton
GO:0097542	0.849	ciliary tip
GO:0015630	0.848	microtubule cytoskeleton
GO:0005737	0.755	cytoplasm
GO:0005829	0.471	cytosol
GO:0097730	0.451	non-motile cilium
GO:0016020	0.393	membrane
GO:0005815	0.370	microtubule organizing center
GO:0043005	0.337	neuron projection
GO:0031514	0.302	motile cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]