StarFunc result for job id Q8NF50

User Input

>input (2099 residues)
MATLPSAERRAFALKINRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVE
PVDFEGLLMTHLNSLDVQLAQELGDFTDDDLDVVFTPKECRTLQPSLPEEGVELDPHVRD
CVQTYIREWLIVNRKNQGSPEICGFKKTGSRKDFHKTLPKQTFESETLECSEPAAQAGPR
HLNVLCDVSGKGPVTACDFDLRSLQPDKRLENLLQQVSAEDFEKQNEEARRTNRQAELFA
LYPSVDEEDAVEIRPVPECPKEHLGNRILVKLLTLKFEIEIEPLFASIALYDVKERKKIS
ENFHCDLNSDQFKGFLRAHTPSVAASSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGD
CAEPYTVIKESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLSSFFNVSTLERE
VTDVDSVVGRSSVGERRTLAQSRRLSERALSLEENGVGSNFKTSTLSVSSFFKQEGDRLS
DEDLFKFLADYKRSSSLQRRVKSIPGLLRLEISTAPEIINCCLTPEMLPVKPFPENRTRP
HKEILEFPTREVYVPHTVYRNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPV
IFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGA
SVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKG
VFNIEVQAVSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISEMALEHELKLSIICL
NSSRLEPLVLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKD
QHGRNCLLASYVHYVFRLPEVQRDVPKSGAPTALLDPRSYHTYGRTSAAAVSSKLLQARV
MSSSNPDLAGTHSAADEEVKNIMSSKIADRNCSRMSYYCSGSSDAPSSPAAPRPASKKHF
HEELALQMVVSTGMVRETVFKYAWFFFELLVKSMAQHVHNMDKRDSFRRTRFSDRFMDDI
TTIVNVVTSEIAALLVKPQKENEQAEKMNISLAFFLYDLLSLMDRGFVFNLIRHYCSQLS
AKLSNLPTLISMRLEFLRILCSHEHYLNLNLFFMNADTAPTSPCPSISSQNSSSCSSFQD
QKIASMFDLTSEYRQQHFLTGLLFTELAAALDAEGEGISKVQRKAVSAIHSLLSSHDLDP
RCVKPEVKVKIAALYLPLVGIILDALPQLCDFTVADTRRYRTSGSDEEQEGAGAINQNVA
LAIAGNNFNLKTSGIVLSSLPYKQYNMLNADTTRNLMICFLWIMKNADQSLIRKWIADLP
STQLNRILDLLFICVLCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMR
RRAPGNDRFPGLNENLRWKKEQTHWRQANEKLDKTKAELDQEALISGNLATEAHLIILDM
QENIIQASSALDCKDSLLGGVLRVLVNSLNCDQSTTYLTHCFATLRALIAKFGDLLFEEE
VEQCFDLCHQVLHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMSLASLVG
RAPDFNEEHLRRSLRTILAYSEEDTAMQMTPFPTQVEELLCNLNSILYDTVKMREFQEDP
EMLMDLMYRIAKSYQASPDLRLTWLQNMAEKHTKKKCYTEAAMCLVHAAALVAEYLSMLE
DHSYLPVGSVSFQNISSNVLEESVVSEDTLSPDEDGVCAGQYFTESGLVGLLEQAAELFS
TGGLYETVNEVYKLVIPILEAHREFRKLTLTHSKLQRAFDSIVNKDHKRMFGTYFRVGFF
GSKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPNK
AYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLT
TMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQGS
VGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQR
EYQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AF47	0.509	0.515	0.000	2073	0.303	0.306	A2AF47.pdb.gz	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
2	AFDB:M9PCG3	0.552	0.509	0.000	2298	0.285	0.261	M9PCG3.pdb.gz	M9PCG3_DROME Zizimin, isoform K OS=Drosophila melanogaster OX=7227 GN=Ziz PE=1 SV=1
3	AFDB:Q8BIK4	0.512	0.522	0.000	2055	0.289	0.295	Q8BIK4.pdb.gz	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
4	AFDB:Q8BZN6	0.581	0.570	0.000	2150	0.283	0.277	Q8BZN6.pdb.gz	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
5	AFDB:Q8C147	0.798	0.797	0.000	2100	0.919	0.919	Q8C147.pdb.gz	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
6	AFDB:Q96HP0	0.750	0.767	0.000	2047	0.519	0.532	Q96HP0.pdb.gz	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
7	AFDB:Q96N67	0.759	0.746	0.000	2140	0.571	0.560	Q96N67.pdb.gz	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
8	AFDB:Q9BZ29	0.503	0.509	0.000	2069	0.292	0.296	Q9BZ29.pdb.gz	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
9	AFDB:Q9VPI9	0.666	0.676	0.000	2064	0.427	0.434	Q9VPI9.pdb.gz	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
10	AFDB:Q86I66	0.563	0.522	1.448E-93	2284	0.249	0.229	Q86I66.pdb.gz	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
11	PDB:6tgbA	0.299	0.406	3.999E-21	1450	0.090	0.130	6tgbA.pdb.gz
12	PDB:3gjxA	0.081	0.123	3.940E-5	1041	0.053	0.108	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
13	PDB:7jq9A	0.105	0.096	9.615E-5	2427	0.073	0.063	7jq9A.pdb.gz
14	PDB:7unkA	0.074	0.121	1.140E-4	1047	0.067	0.134	7unkA.pdb.gz
15	PDB:7mq8LM	0.075	0.077	1.351E-4	2005	0.077	0.080	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:3w3zA	0.075	0.108	1.534E-4	1013	0.048	0.099	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
17	PDB:6q82A	0.086	0.133	2.065E-4	1027	0.070	0.142	6q82A.pdb.gz	Structural basis for the nuclear import and export functions of the biportin Pdr6/Kap122.
18	PDB:4a0cA	0.076	0.106	2.248E-4	1155	0.069	0.126	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
19	PDB:7mopA	0.105	0.094	2.248E-4	2445	0.069	0.059	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
20	PDB:7t3pA	0.075	0.076	2.248E-4	2066	0.084	0.086	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7ESB7	0.0	2083	2082	0.523	0.527	K7ESB7_HUMAN Dedicator of cytokinesis 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=2
2	Q8C147	0.0	4001	2100	0.919	0.919	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
3	Q8NF50	0.0	4363	2099	1.000	1.000	DOCK8_HUMAN Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8 PE=1 SV=3
4	Q8R1A4	0.0	2301	2130	0.572	0.563	DOCK7_MOUSE Dedicator of cytokinesis protein 7 OS=Mus musculus OX=10090 GN=Dock7 PE=1 SV=3
5	Q96HP0	0.0	2063	2047	0.518	0.531	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
6	Q96N67	0.0	2304	2140	0.572	0.561	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
7	Q9VPI9	0.0	1632	2064	0.433	0.440	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
8	A2AF47	1.30e-174	589	2073	0.188	0.191	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
9	Q5JSL3	1.32e-174	589	2073	0.187	0.190	DOC11_HUMAN Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2
10	Q9BZ29	8.60e-163	555	2069	0.187	0.189	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
11	Q96BY6	1.11e-158	544	2186	0.179	0.172	DOC10_HUMAN Dedicator of cytokinesis protein 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=3
12	A0A2R8YD85	1.33e-158	544	2199	0.179	0.171	A0A2R8YD85_HUMAN Dedicator of cytokinesis 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=1
13	Q8BZN6	5.99e-156	536	2187	0.176	0.169	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
14	Q8BIK4	1.04e-155	534	2055	0.182	0.185	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
15	M9PCG3	5.01e-123	436	2298	0.131	0.120	M9PCG3_DROME Zizimin, isoform K OS=Drosophila melanogaster OX=7227 GN=Ziz PE=1 SV=1
16	Q86I66	1.87e-106	383	2284	0.111	0.102	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
17	Q54CA8	2.07e-77	288	2147	0.097	0.095	Q54CA8_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizB PE=3 SV=1
18	Q8SAB7	2.11e-52	206	1830	0.102	0.117	SPK1_ARATH Guanine nucleotide exchange factor SPIKE 1 OS=Arabidopsis thaliana OX=3702 GN=SPK1 PE=1 SV=1
19	Q8CIQ7	3.62e-13	78.2	2027	0.040	0.041	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1
20	Q8IZD9	1.25e-12	76.3	2030	0.040	0.041	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	4.2e-52	188.1	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	9.4e-25	97.9	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	4.3e-34	127.9	DHR-2, Lobe C
4	PF14429 DOCK-C2	5.7e-45	165.0	C2 domain in Dock180 and Zizimin proteins
5	PF11878 DOCK_C-D_N	1.7e-24	97.9	Dedicator of cytokinesis C/D, N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394888

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.995	Cell division control protein 42 homolog
2	9606.ENSP00000374447	0.925	Leucine-rich repeat and calponin homology domain-containing protein 1
3	9606.ENSP00000477725	0.904	KN motif and ankyrin repeat domain-containing protein 1
4	9606.ENSP00000428924	0.885	Tyrosine-protein kinase Lyn
5	9606.ENSP00000365891	0.860	Wiskott-Aldrich syndrome protein
6	9606.ENSP00000334375	0.838	Leucine rich repeats and calponin homology domain containing 3
7	9606.ENSP00000348461	0.806	Ras-related C3 botulinum toxin substrate 1
8	9606.ENSP00000401399	0.803	Myeloid differentiation primary response protein MyD88
9	9606.ENSP00000371711	0.766	Doublesex- and mab-3-related transcription factor 1
10	9606.ENSP00000316729	0.744	Rho-related GTP-binding protein RhoJ
11	9606.ENSP00000294618	0.734	Dedicator of cytokinesis protein 6
12	9606.ENSP00000251157	0.728	Dedicator of cytokinesis protein 7
13	9606.ENSP00000411355	0.711	Receptor-type tyrosine-protein phosphatase C
14	9606.ENSP00000325091	0.706	Leucine rich repeats and calponin homology domain containing 2
15	9606.ENSP00000361048	0.694	Leucine rich adaptor protein 1
16	9606.ENSP00000425809	0.691	Phosphoacetylglucosamine mutase
17	9606.ENSP00000309689	0.687	Leucine rich repeats and calponin homology domain containing 4
18	9606.ENSP00000264657	0.684	Signal transducer and activator of transcription 3
19	9606.ENSP00000228825	0.680	Actin-related protein 2/3 complex subunit 3
20	9606.ENSP00000334958	0.676	Capping protein, Arp2/3 and myosin-I linker protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005085	0.999	guanyl-nucleotide exchange factor activity
GO:0019899	0.502	enzyme binding
GO:0031267	0.411	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0002682	0.994	regulation of immune system process
GO:0030155	0.993	regulation of cell adhesion
GO:0009987	0.992	cellular process
GO:0048522	0.992	positive regulation of cellular process
GO:0051239	0.991	regulation of multicellular organismal process
GO:0040012	0.986	regulation of locomotion
GO:0030334	0.982	regulation of cell migration
GO:0050896	0.951	response to stimulus
GO:0032501	0.951	multicellular organismal process
GO:0001775	0.942	cell activation
GO:1903037	0.938	regulation of leukocyte cell-cell adhesion
GO:0002684	0.937	positive regulation of immune system process
GO:0050867	0.935	positive regulation of cell activation
GO:0051251	0.932	positive regulation of lymphocyte activation
GO:1903039	0.930	positive regulation of leukocyte cell-cell adhesion
GO:0071675	0.926	regulation of mononuclear cell migration
GO:0050863	0.924	regulation of T cell activation
GO:0002376	0.922	immune system process
GO:2000404	0.916	regulation of T cell migration
GO:0045321	0.914	leukocyte activation
GO:0002687	0.910	positive regulation of leukocyte migration
GO:0050870	0.902	positive regulation of T cell activation
GO:0051056	0.893	regulation of small GTPase mediated signal transduction
GO:0046649	0.888	lymphocyte activation
GO:0071677	0.885	positive regulation of mononuclear cell migration
GO:0032878	0.882	regulation of establishment or maintenance of cell polarity
GO:2000403	0.845	positive regulation of lymphocyte migration
GO:0042110	0.810	T cell activation
GO:2000114	0.804	regulation of establishment of cell polarity
GO:0051716	0.801	cellular response to stimulus
GO:0065009	0.710	regulation of molecular function
GO:0046651	0.684	lymphocyte proliferation
GO:0042098	0.668	T cell proliferation
GO:0032502	0.596	developmental process
GO:0050790	0.542	regulation of catalytic activity
GO:0048856	0.538	anatomical structure development
GO:0019222	0.483	regulation of metabolic process
GO:0071840	0.481	cellular component organization or biogenesis
GO:0048519	0.479	negative regulation of biological process
GO:0042221	0.476	response to chemical
GO:0044093	0.465	positive regulation of molecular function
GO:0048523	0.460	negative regulation of cellular process
GO:0016043	0.430	cellular component organization
GO:0051336	0.420	regulation of hydrolase activity
GO:0043085	0.401	positive regulation of catalytic activity
GO:0010033	0.387	response to organic substance
GO:0060255	0.382	regulation of macromolecule metabolic process
GO:0009893	0.348	positive regulation of metabolic process
GO:0080090	0.338	regulation of primary metabolic process
GO:0031323	0.338	regulation of cellular metabolic process
GO:0010604	0.312	positive regulation of macromolecule metabolic process
GO:0034097	0.306	response to cytokine
GO:0048584	0.302	positive regulation of response to stimulus
GO:0051171	0.301	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.980	membrane
GO:0071944	0.976	cell periphery
GO:0005737	0.975	cytoplasm
GO:0005886	0.958	plasma membrane
GO:0005829	0.958	cytosol
GO:0043229	0.776	intracellular organelle
GO:0043227	0.775	membrane-bounded organelle
GO:0043231	0.753	intracellular membrane-bounded organelle
GO:0031252	0.708	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]