StarFunc result for job id Q8NF64

User Input

>input (920 residues)
MNSMNPMKPALPPAPHGDGSFAYESVPWQQSATQPAGSLSVVTTVWGVGNATQSQVLGNP
MGPAGSPSGSSMMPGVAGGSSALTSPQCLGQQAFAEGGANKGYVQQGVYSRGGYPGAPGF
TTGYAGGPGGLGLPSHAARPSTDFTQAAAAAAVAAAAATATATATATVAALQEKQSQELS
QYGAMGAGQSFNSQFLQHGGPRGPSVPAGMNPTGIGGVMGPSGLSPLAMNPTRAAGMTPL
YAGQRLPQHGYPGPPQAQPLPRQGVKRTYSEVYPGQQYLQGGQYAPSTAQFAPSPGQPPA
PSPSYPGHRLPLQQGMTQSLSVPGPTGLHYKPTEQFNGQGASFNGGSVSYSQPGLSGPTR
SIPGYPSSPLPGNPTPPMTPSSSVPYMSPNQEVKSPFLPDLKPNLNSLHSSPSGSGPCDE
LRLTFPVRDGVVLEPFRLQHNLAVSNHVFQLRDSVYKTLIMRPDLELQFKCYHHEDRQMN
TNWPASVQVSVNATPLTIERGDNKTSHKPLYLKHVCQPGRNTIQITVTACCCSHLFVLQL
VHRPSVRSVLQGLLKKRLLPAEHCITKIKRNFSSGTIPGTPGPNGEDGVEQTAIKVSLKC
PITFRRIQLPARGHDCRHIQCFDLESYLQLNCERGTWRCPVCNKTALLEGLEVDQYMLGI
LIYIQNSDYEEITIDPTCSWKPVPVKPDMHIKEEPDGPALKRCRTVSPAHVLMPSVMEMI
AALGPGAAPFAPLQPPSVPAPSDYPGQGSSFLGPGTFPESFPPTTPSTPTLAEFTPGPPP
ISYQSDIPSSLLTSEKSTACLPSQMAPAGHLDPTHNPGTPGLHTSNLGAPPGPQLHHSNP
PPASRQSLGQASLGPTGELAFSPATGVMGPPSMSGAGEAPEPALDLLPELTNPDELLSYL
GPPDLPTNNNDDLLSLFENN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IW44	0.391	0.398	0.000	902	0.679	0.693	A0A0R4IW44.pdb.gz
2	AFDB:Q8NF64	0.999	0.999	0.000	920	1.000	1.000	Q8NF64.pdb.gz	ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZMIZ2 PE=1 SV=2
3	AFDB:A0A0A7EPL0	0.192	0.205	1.635E-10	847	0.107	0.116	A0A0A7EPL0.pdb.gz	PIAL1_ARATH E4 SUMO-protein ligase PIAL1 OS=Arabidopsis thaliana OX=3702 GN=PIAL1 PE=1 SV=1
4	AFDB:E1JGN0	0.059	0.052	1.813E-5	1141	0.134	0.108	E1JGN0.pdb.gz	E1JGN0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
5	AFDB:D4A0I8	0.074	0.073	4.138E-5	931	0.165	0.163	D4A0I8.pdb.gz	D4A0I8_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
6	AFDB:A0A1D5PNG2	0.057	0.058	5.895E-5	890	0.136	0.140	A0A1D5PNG2.pdb.gz
7	AFDB:P41696	0.050	0.050	1.346E-4	914	0.145	0.146	P41696.pdb.gz	AZF1_YEAST Transcription factor AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AZF1 PE=1 SV=1
8	AFDB:M0RDF1	0.064	0.038	4.925E-4	1724	0.172	0.092	M0RDF1.pdb.gz	M0RDF1_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=2
9	AFDB:D3ZE20	0.061	0.066	6.613E-4	827	0.134	0.149	D3ZE20.pdb.gz	D3ZE20_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=4
10	AFDB:Q70HU3	0.041	0.037	8.373E-4	1135	0.163	0.132	Q70HU3.pdb.gz	Q70HU3_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
11	PDB:5eiyB	0.090	0.118	4.052E-3	658	0.032	0.044	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
12	PDB:4r8pL	0.072	0.246	1.104E-2	254	0.026	0.094	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:2waaA	0.071	0.170	2.674E-2	335	0.020	0.054	2waaA.pdb.gz
14	PDB:5jm0A	0.088	0.087	4.285E-2	940	0.024	0.023	5jm0A.pdb.gz
15	PDB:1olmE	0.066	0.136	5.755E-2	397	0.014	0.033	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
16	PDB:3i26D	0.071	0.143	7.728E-2	369	0.015	0.038	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
17	PDB:5vqfB	0.095	0.224	9.223E-2	320	0.017	0.050	5vqfB.pdb.gz
18	PDB:1js9C	0.068	0.226	9.783E-2	189	0.012	0.058	1js9C.pdb.gz
19	PDB:7y1rB	0.086	0.199	1.038E-1	308	0.022	0.065	7y1rB.pdb.gz
20	PDB:4uybA	0.062	0.124	1.101E-1	401	0.017	0.040	4uybA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EWM3	0.0	1779	888	0.965	1.000	E7EWM3_HUMAN Zinc finger MIZ-type containing 2 OS=Homo sapiens OX=9606 GN=ZMIZ2 PE=1 SV=1
2	Q6P1E1	0.0	945	1072	0.622	0.534	ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zmiz1 PE=1 SV=1
3	Q8NF64	0.0	1852	920	1.000	1.000	ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZMIZ2 PE=1 SV=2
4	Q9ULJ6	0.0	969	1067	0.627	0.541	ZMIZ1_HUMAN Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZMIZ1 PE=1 SV=3
5	Q7JR52	3.97e-123	402	1109	0.203	0.169	Q7JR52_DROME LD16921p OS=Drosophila melanogaster OX=7227 GN=tna PE=1 SV=1
6	Q9VTB8	5.21e-123	402	1135	0.203	0.165	Q9VTB8_DROME Tonalli, isoform A OS=Drosophila melanogaster OX=7227 GN=tna PE=1 SV=3
7	Q7KUE4	4.94e-122	400	1149	0.203	0.163	Q7KUE4_DROME Tonalli, isoform B OS=Drosophila melanogaster OX=7227 GN=tna PE=1 SV=1
8	A1Z7P5	2.73e-19	95.5	640	0.062	0.089	A1Z7P5_DROME Suppressor of variegation 2-10, isoform I OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
9	A1Z7Q1	4.04e-19	94.7	593	0.062	0.096	A1Z7Q1_DROME Suppressor of variegation 2-10, isoform B OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
10	A0A0B4LEH9	4.31e-19	94.4	577	0.062	0.099	A0A0B4LEH9_DROME Suppressor of variegation 2-10, isoform N OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
11	A1Z7P7	4.82e-19	94.4	569	0.062	0.100	A1Z7P7_DROME Suppressor of variegation 2-10, isoform H OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
12	Q8IGK3	4.98e-19	94.4	601	0.062	0.095	Q8IGK3_DROME RE73180p OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
13	F4JYG0	5.05e-19	94.7	760	0.051	0.062	PIAL2_ARATH E4 SUMO-protein ligase PIAL2 OS=Arabidopsis thaliana OX=3702 GN=PIAL2 PE=1 SV=1
14	A1Z7P8	5.16e-19	94.4	604	0.062	0.094	A1Z7P8_DROME Suppressor of variegation 2-10, isoform G OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
15	A0A0B4K6T9	5.97e-19	94.0	570	0.062	0.100	A0A0B4K6T9_DROME Suppressor of variegation 2-10, isoform M OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
16	O94451	6.00e-19	94.7	727	0.058	0.073	PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pli1 PE=1 SV=3
17	Q6L4L4	6.36e-19	94.7	875	0.084	0.088	SIZ1_ORYSJ E3 SUMO-protein ligase SIZ1 OS=Oryza sativa subsp. japonica OX=39947 GN=SIZ1 PE=1 SV=1
18	Q6ASW7	7.07e-19	94.4	813	0.068	0.077	SIZ2_ORYSJ E3 SUMO-protein ligase SIZ2 OS=Oryza sativa subsp. japonica OX=39947 GN=SIZ2 PE=2 SV=1
19	A0A0B4JD33	7.22e-19	94.0	584	0.062	0.098	A0A0B4JD33_DROME Suppressor of variegation 2-10, isoform L OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
20	Q7KNF5	8.46e-19	93.6	554	0.062	0.103	Q7KNF5_DROME Suppressor of variegation 2-10, isoform A OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02891 zf-MIZ	2.1e-18	77.1	MIZ/SP-RING zinc finger
2	PF11789 zf-Nse	0.033	25.4	Zinc-finger of the MIZ type in Nse subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311778

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348056	0.784	SUMO-conjugating enzyme UBC9
2	9606.ENSP00000323967	0.753	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
3	9606.ENSP00000395654	0.733	Transcription activator BRG1
4	9606.ENSP00000268124	0.700	DNA polymerase subunit gamma-1
5	9606.ENSP00000257867	0.658	Extracellular glycoprotein lacritin
6	9606.ENSP00000313670	0.648	ALS2 C-terminal-like protein
7	9606.ENSP00000368458	0.644	Proliferating cell nuclear antigen
8	9606.ENSP00000264501	0.631	Uncharacterized protein KIAA1109
9	9606.ENSP00000287437	0.617	E3 SUMO-protein ligase NSE2
10	9606.ENSP00000383365	0.605	Thioredoxin reductase 2, mitochondrial
11	9606.ENSP00000262139	0.588	WD repeat domain phosphoinositide-interacting protein 1
12	9606.ENSP00000344465	0.588	Platelet endothelial aggregation receptor 1
13	9606.ENSP00000378857	0.575	WD repeat-containing protein 6
14	9606.ENSP00000339495	0.564	Negative elongation factor B
15	9606.ENSP00000364346	0.561	Zinc finger protein 341
16	9606.ENSP00000246548	0.558	SUMO-activating enzyme subunit 2
17	9606.ENSP00000379865	0.556	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
18	9606.ENSP00000453129	0.554	N-acetylgalactosamine kinase
19	9606.ENSP00000270747	0.545	Rho guanine nucleotide exchange factor 19
20	9606.ENSP00000323678	0.542	Prostaglandin reductase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030374	0.996	nuclear receptor coactivator activity
GO:0003824	0.474	catalytic activity
GO:0016740	0.422	transferase activity
GO:0140096	0.418	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0019222	0.972	regulation of metabolic process
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0080090	0.947	regulation of primary metabolic process
GO:0051171	0.934	regulation of nitrogen compound metabolic process
GO:0031323	0.915	regulation of cellular metabolic process
GO:0048522	0.901	positive regulation of cellular process
GO:0019219	0.901	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.895	positive regulation of nitrogen compound metabolic process
GO:0009889	0.885	regulation of biosynthetic process
GO:2001141	0.875	regulation of RNA biosynthetic process
GO:0031325	0.874	positive regulation of cellular metabolic process
GO:0010604	0.870	positive regulation of macromolecule metabolic process
GO:0006355	0.868	regulation of DNA-templated transcription
GO:0006357	0.773	regulation of transcription by RNA polymerase II
GO:0045935	0.770	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.767	positive regulation of macromolecule biosynthetic process
GO:0031328	0.765	positive regulation of cellular biosynthetic process
GO:1902680	0.751	positive regulation of RNA biosynthetic process
GO:0045944	0.664	positive regulation of transcription by RNA polymerase II
GO:0009987	0.645	cellular process
GO:0008152	0.376	metabolic process
GO:0050896	0.334	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0005739	0.951	mitochondrion
GO:0043232	0.846	intracellular non-membrane-bounded organelle
GO:0005694	0.693	chromosome
GO:0000228	0.576	nuclear chromosome
GO:0043596	0.395	nuclear replication fork
GO:0032991	0.370	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.422	Transferases.

[back to server]