StarFunc result for job id Q8NF91

User Input

>input (1400 residues)
MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPS
IVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNA
KKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLE
DAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP
GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEM
KRKQIEHLIQPLHRDGKLSLDQALVKQSWDRVTSRLFDWHIQLDKSLPAPLGTIGAWLYR
AEVALREEITVQQVHEETANTIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPD
QLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLL
QNYVSFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRNLSVE
VRSVRSMLEEVISNWDRYGNTVASLQAWLEDAEKMLNQSENAKKDFFRNLPHWIQQHTAM
NDAGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVKQYAQADEMDRMKKEYTDCVVTL
SAFATEAHKKLSEPLEVSFMNVKLLIQDLEDIEQRVPVMDAQYKIITKTAHLITKESPQE
EGKEMFATMSKLKEQLTKVKECYSPLLYESQQLLIPLEELEKQMTSFYDSLGKINEIITV
LEREAQSSALFKQKHQELLACQENCKKTLTLIEKGSQSVQKFVTLSNVLKHFDQTRLQRQ
IADIHVAFQSMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRIAQEGLEEKGDPEELL
RRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQGEAPYHLL
HLKIDVEKNRFLASVEECRTELDRETKLMPQEGSEKIIKEHRVFFSDKGPHHLCEKRLQL
IEELCVKLPVRDPVRDTPGTCHVTLKELRAAIDSTYRKLMEDPDKWKDYTSRFSEFSSWI
STNETQLKGIKGEAIDTANHGEVKRAVEEIRNGVTKRGETLSWLKSRLKVLTEVSSENEA
QKQGDELAKLSSSFKALVTLLSEVEKMLSNFGDCVQYKEIVKNSLEELISGSKEVQEQAE
KILDTENLFEAQQLLLHHQQKTKRISAKKRDVQQQIAQAQQGEGGLPDRGHEELRKLEST
LDGLERSRERQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELE
QTKEFSKRTESIAVQAENLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63128	0.280	0.392	5.660E-79	941	0.549	0.817	Q63128.pdb.gz	Q63128_RAT CPG2 protein OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
2	AFDB:O15020	0.168	0.099	7.692E-29	2390	0.214	0.125	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
3	AFDB:Q00963	0.164	0.102	1.028E-28	2291	0.179	0.110	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
4	AFDB:E0AHA7	0.192	0.125	1.072E-28	2326	0.189	0.113	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
5	AFDB:P11277	0.169	0.111	2.783E-28	2137	0.191	0.125	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
6	AFDB:Q01082	0.166	0.099	1.346E-27	2364	0.203	0.120	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
7	AFDB:F1QQE5	0.170	0.102	3.148E-26	2357	0.191	0.114	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
8	AFDB:Q9H254	0.246	0.166	6.366E-24	2564	0.182	0.099	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
9	AFDB:Q503P9	0.168	0.294	5.979E-23	786	0.129	0.229	Q503P9.pdb.gz
10	AFDB:Q8I6B6	0.165	0.867	2.606E-21	256	0.105	0.574	Q8I6B6.pdb.gz	Q8I6B6_DROME MSP-300 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=2 SV=1
11	PDB:4d1eA	0.152	0.244	4.956E-15	859	0.122	0.199	4d1eA.pdb.gz
12	PDB:1sjjA	0.088	0.133	8.663E-12	863	0.111	0.180	1sjjA.pdb.gz
13	PDB:7sx8D	0.127	0.346	1.280E-4	448	0.039	0.121	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:7t3uC	0.080	0.075	2.816E-4	1575	0.123	0.109	7t3uC.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
15	PDB:7qdrB	0.064	0.070	5.699E-4	1212	0.112	0.130	7qdrB.pdb.gz
16	PDB:7sqcR1	0.073	0.061	1.062E-3	2080	0.114	0.077	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:7mq8LM	0.064	0.058	1.747E-3	2005	0.124	0.086	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:6zwmB	0.055	0.044	2.644E-3	2185	0.121	0.078	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
19	PDB:6uqkA	0.079	0.065	2.756E-3	2054	0.112	0.076	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.
20	PDB:6bcuA	0.081	0.062	3.535E-3	2204	0.141	0.090	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DG40	0.0	2897	8749	1.000	0.160	A0A0C4DG40_HUMAN Spectrin repeat containing nuclear envelope protein 1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1
2	A0A5P8DHK4	0.0	2459	8697	0.869	0.140	A0A5P8DHK4_RAT Nesprin 1 short isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
3	A0A5P8DHN0	0.0	2459	8815	0.869	0.138	A0A5P8DHN0_RAT Nesprin 1 long isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
4	A0A8I5ZJB9	0.0	2459	8815	0.869	0.138	A0A8I5ZJB9_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
5	A0A8I6ABC0	0.0	2458	8788	0.869	0.138	A0A8I6ABC0_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
6	Q63128	0.0	1525	941	0.550	0.818	Q63128_RAT CPG2 protein OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
7	Q6ZWR6	0.0	2427	8799	0.860	0.137	SYNE1_MOUSE Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2
8	Q8NF91	0.0	2904	8797	1.000	0.159	SYNE1_HUMAN Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4
9	M9MRD6	6.96e-171	571	11999	0.279	0.033	M9MRD6_DROME Muscle-specific protein 300 kDa, isoform I OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
10	M9MRF5	7.57e-171	570	11986	0.279	0.033	M9MRF5_DROME Muscle-specific protein 300 kDa, isoform H OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
11	M9PCM8	9.21e-171	570	11917	0.279	0.033	M9PCM8_DROME Muscle-specific protein 300 kDa, isoform K OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
12	M9MRD4	1.20e-169	567	8382	0.278	0.046	M9MRD4_DROME Muscle-specific protein 300 kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
13	M9PC84	1.53e-169	566	12308	0.278	0.032	M9PC84_DROME Muscle-specific protein 300 kDa, isoform L OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
14	M9MRD1	2.01e-169	566	12345	0.278	0.032	MS300_DROME Muscle-specific protein 300 kDa OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
15	M9PC23	4.78e-167	559	7962	0.279	0.049	M9PC23_DROME Muscle-specific protein 300 kDa, isoform J OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
16	Q8WXH0	3.17e-113	398	6885	0.177	0.036	SYNE2_HUMAN Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3
17	G3V5X4	4.73e-113	397	6818	0.177	0.036	G3V5X4_HUMAN Spectrin repeat containing nuclear envelope protein 2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=1
18	Q6ZWQ0	6.70e-111	391	6874	0.175	0.036	SYNE2_MOUSE Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 SV=2
19	Q8I6B6	9.82e-91	296	256	0.106	0.578	Q8I6B6_DROME MSP-300 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=2 SV=1
20	Q8C5W0	1.15e-69	257	1052	0.103	0.137	CLMN_MOUSE Calmin OS=Mus musculus OX=10090 GN=Clmn PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	6.6e-05	34.0	CAMSAP CH domain
2	PF00307 CH	3.7e-41	151.1	Calponin homology (CH) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356224

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384015	0.999	SUN domain-containing protein 1
2	9606.ENSP00000385616	0.999	SUN domain-containing protein 2
3	9606.ENSP00000357283	0.993	Prelamin-A/C
4	9606.ENSP00000261366	0.967	Lamin-B1
5	9606.ENSP00000358857	0.963	Emerin
6	9606.ENSP00000363571	0.940	Muscle, skeletal receptor tyrosine-protein kinase
7	9606.ENSP00000334308	0.931	Nesprin-3
8	9606.ENSP00000350719	0.930	Nesprin-2
9	9606.ENSP00000364864	0.910	Kinesin-like protein KIF3B
10	9606.ENSP00000297325	0.885	SUN domain-containing protein 3
11	9606.ENSP00000316130	0.878	Nesprin-4
12	9606.ENSP00000404220	0.848	Protein KASH5
13	9606.ENSP00000363391	0.804	Sperm-associated antigen 4 protein
14	9606.ENSP00000364691	0.782	Rootletin
15	9606.ENSP00000327054	0.767	Lamin-B2
16	9606.ENSP00000348496	0.746	SUN domain-containing protein 5
17	9606.ENSP00000345395	0.745	Papilin, proteoglycan like sulfated glycoprotein
18	9606.ENSP00000335304	0.728	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
19	9606.ENSP00000373620	0.726	60 kDa heat shock protein, mitochondrial
20	9606.ENSP00000361634	0.699	Endophilin-B2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0019899	1.000	enzyme binding
GO:0005102	0.998	signaling receptor binding
GO:0008092	0.486	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0061061	0.977	muscle structure development
GO:0048513	0.964	animal organ development
GO:0032501	0.940	multicellular organismal process
GO:0065007	0.935	biological regulation
GO:0009987	0.891	cellular process
GO:0010464	0.846	regulation of mesenchymal cell proliferation
GO:0098815	0.846	modulation of excitatory postsynaptic potential
GO:0072359	0.840	circulatory system development
GO:0007507	0.811	heart development
GO:0030154	0.706	cell differentiation
GO:0048523	0.672	negative regulation of cellular process
GO:0035051	0.614	cardiocyte differentiation
GO:0048259	0.595	regulation of receptor-mediated endocytosis
GO:0048260	0.583	positive regulation of receptor-mediated endocytosis
GO:0002090	0.552	regulation of receptor internalization
GO:0031344	0.547	regulation of cell projection organization
GO:0043067	0.543	regulation of programmed cell death
GO:0050896	0.542	response to stimulus
GO:0048814	0.530	regulation of dendrite morphogenesis
GO:0055007	0.524	cardiac muscle cell differentiation
GO:0060548	0.495	negative regulation of cell death
GO:0043069	0.469	negative regulation of programmed cell death
GO:0033043	0.467	regulation of organelle organization
GO:0007417	0.450	central nervous system development
GO:0009628	0.392	response to abiotic stimulus
GO:0007420	0.390	brain development
GO:0042981	0.364	regulation of apoptotic process
GO:0051179	0.359	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0005635	0.990	nuclear envelope
GO:0005737	0.981	cytoplasm
GO:0016020	0.975	membrane
GO:0043228	0.950	non-membrane-bounded organelle
GO:0043232	0.933	intracellular non-membrane-bounded organelle
GO:0031965	0.914	nuclear membrane
GO:0030054	0.861	cell junction
GO:0120025	0.820	plasma membrane bounded cell projection
GO:0098794	0.807	postsynapse
GO:0044327	0.797	dendritic spine head
GO:0005856	0.787	cytoskeleton
GO:0005794	0.775	Golgi apparatus
GO:0015630	0.751	microtubule cytoskeleton
GO:0048471	0.750	perinuclear region of cytoplasm
GO:0070013	0.639	intracellular organelle lumen
GO:0031981	0.624	nuclear lumen
GO:0005654	0.468	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]