StarFunc result for job id Q8NFA0

User Input

>input (1604 residues)
MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTCGLSYYMGQHCFIREVLGDGVPPKV
AEVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYIFSLFSSESGNYVIREEMERML
HVVDGKVPDTLRKCFSEGEKVNYEKFRNWLFLNKDAFTFSRWLLSGGVYVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAF
DENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVW
KDNRTDDIPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQIWSVKNVLANEFLNLLFQVC
HIVLGLRPATPEEEGQIIRGWLERESRYGLQAGHNWFIISMQWWQQWKEYVKYDANPVVI
EPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLSYVNTTEEKFSDNISTASEASETAGSGFL
YSATPGADVCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVKATSL
TLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPVIKNSKTDIPELELFPR
YLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLR
IKEEDMRLWLYNSENYLTLLDDEDHKLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSS
KIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMK
GHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHED
LNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHIS
VRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLSDLCGLN
SEQILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPVPVSPISASSPTQTDFSSSPST
NEMFTLTTNGDLPRPIFIPNGMPNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYIIAVH
RKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASN
HAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNAYIAVDWD
PTALHLRYQTSQERVVDEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCK
THCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLVPRDPALC
QHKPLTPQGDELSEPRILAREVKKVDAQSSAGEEDVLLSKSPSSLSANIISSPKGSPSSS
RKSGTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDASKENGAGQICE
LADALSRGHVLGGSQPELVTPQDHEVALANGFLYEHEACGNGYSNGQLGNHSEEDSTDDQ
REDTRIKPIYNLYAISCHSGILGGGHYVTYAKNPNCKWYCYNDSSCKELHPDEIDTDSAY
ILFYEQQGIDYAQFLPKTDGKKMADTSSMDEDFESDYKKYCVLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFA0	1.000	1.000	0.000	1604	1.000	1.000	Q8NFA0.pdb.gz	UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
2	AFDB:A0A024R2X6	0.308	0.514	5.106E-65	916	0.182	0.319	A0A024R2X6.pdb.gz
3	AFDB:A1LPW7	0.309	0.489	2.722E-64	963	0.184	0.306	A1LPW7.pdb.gz
4	AFDB:Q9R085	0.319	0.507	6.936E-64	952	0.176	0.297	Q9R085.pdb.gz	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
5	AFDB:Q8R5H1	0.308	0.480	9.067E-62	981	0.181	0.297	Q8R5H1.pdb.gz	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
6	AFDB:Q5D006	0.291	0.480	3.104E-61	921	0.172	0.300	Q5D006.pdb.gz	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
7	AFDB:E7EZD6	0.310	0.474	1.062E-60	1009	0.180	0.285	E7EZD6.pdb.gz	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
8	AFDB:Q70EL4	0.279	0.381	5.693E-37	1123	0.115	0.164	Q70EL4.pdb.gz	UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens OX=9606 GN=USP43 PE=1 SV=2
9	AFDB:D3ZN39	0.211	0.310	9.059E-26	1081	0.115	0.170	D3ZN39.pdb.gz	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
10	AFDB:P40818	0.209	0.297	3.258E-25	1118	0.110	0.158	P40818.pdb.gz	UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1
11	PDB:5cvnB	0.160	0.747	7.595E-12	321	0.056	0.280	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
12	PDB:3mhsA	0.174	0.574	2.475E-11	455	0.057	0.200	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
13	PDB:5k16B	0.150	0.694	2.408E-9	328	0.057	0.280	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:3ihpB	0.165	0.372	1.222E-8	681	0.059	0.140	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
15	PDB:4fjcE	0.153	0.520	9.197E-8	434	0.059	0.219	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
16	PDB:5aanA	0.099	0.768	1.236E-7	183	0.026	0.230	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
17	PDB:7ukhI	0.096	0.688	1.744E-7	181	0.026	0.227	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
18	PDB:7w3ax	0.169	0.512	3.307E-7	494	0.065	0.213	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
19	PDB:5x9aB	0.100	0.681	7.269E-7	198	0.029	0.232	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition
20	PDB:1s1eA	0.099	0.758	8.021E-7	181	0.025	0.221	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EKZ1	0.0	1739	847	0.519	0.982	K7EKZ1_HUMAN ubiquitinyl hydrolase 1 (Fragment) OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
2	K7EQL6	0.0	2668	1274	0.794	1.000	K7EQL6_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
3	P35125	0.0	1650	1406	0.532	0.607	UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens OX=9606 GN=USP6 PE=1 SV=2
4	Q8NFA0	0.0	3352	1604	1.000	1.000	UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
5	Q8WT44	1.06e-84	306	1178	0.161	0.220	UBPH_CAEEL Ubiquitin carboxyl-terminal hydrolase cyk-3 OS=Caenorhabditis elegans OX=6239 GN=cyk-3 PE=1 SV=1
6	G5E9A6	2.07e-82	294	920	0.120	0.209	G5E9A6_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=1
7	P51784	3.11e-82	295	963	0.120	0.199	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
8	Q9R085	6.18e-81	290	952	0.108	0.182	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
9	Q5D006	2.16e-79	285	921	0.099	0.172	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
10	Q9Y4E8	6.57e-78	282	981	0.107	0.175	UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3
11	Q8R5H1	3.86e-77	280	981	0.103	0.169	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
12	P35123	8.28e-77	278	962	0.110	0.183	UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus OX=10090 GN=Usp4 PE=1 SV=3
13	Q13107	4.74e-75	273	963	0.112	0.187	UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=3
14	O22207	1.85e-73	267	924	0.114	0.198	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
15	E7EZD6	5.39e-73	268	1009	0.106	0.168	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
16	H7C189	9.16e-63	229	621	0.068	0.176	H7C189_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=1
17	O60079	6.11e-62	233	979	0.146	0.239	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
18	Q3UJD6	1.24e-52	206	1360	0.066	0.078	UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus OX=10090 GN=Usp19 PE=1 SV=1
19	Q6J1Y9	1.28e-52	206	1357	0.066	0.078	UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus OX=10116 GN=Usp19 PE=1 SV=1
20	O94966	1.64e-52	205	1318	0.066	0.080	UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06337 DUSP	1e-23	95.1	DUSP domain
2	PF00036 EF-hand_1	0.00012	32.4	EF hand
3	PF13202 EF-hand_5	0.00099	29.7	EF hand
4	PF13405 EF-hand_6	1.9e-05	35.1	EF-hand domain
5	PF13499 EF-hand_7	0.034	25.9	EF-hand domain pair
6	PF13833 EF-hand_8	6.5	17.9	EF-hand domain pair
7	PF14560 Ubiquitin_2	0.7	21.7	Ubiquitin-like domain
8	PF14836 Ubiquitin_3	0.043	25.1	Ubiquitin-like domain
9	PF00443 UCH	4.3e-96	333.3	Ubiquitin carboxyl-terminal hydrolase
10	PF13423 UCH_1	1.9e-06	39.4	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300896

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478426	0.913	Acts as a GTPase activating protein for RAB5. Does not act on RAB4 or RAB11 (By similarity)
2	9606.ENSP00000478683	0.913	TBC1 domain family, member 3
3	9606.ENSP00000482345	0.839	annotation not available
4	9606.ENSP00000483965	0.737	Acts as a GTPase activating protein for RAB5. Does not act on RAB4 or RAB11 (By similarity)
5	9606.ENSP00000478070	0.640	CWC25 spliceosome associated protein homolog
6	9606.ENSP00000003302	0.625	Ubiquitin carboxyl-terminal hydrolase 28
7	9606.ENSP00000471735	0.617	Probable protease (By similarity). Acts as a sensor of N(6)- methyladenosine methylation on DNA (m6A): recognizes and binds m6A DNA, leading to its degradation .
8	9606.ENSP00000285420	0.615	[Isoform 1]: Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 . May associate with the protein synthesis initiation complex and modify its ubiquitination to repress translation . May also repress DNA synthesis and modify different cellular targets thereby regulating cell growth and proliferation . May also play a role in proteasome assembly and function
9	9606.ENSP00000312981	0.606	U4/U6.U5 tri-snRNP-associated protein 2
10	9606.ENSP00000424707	0.594	Protein kish-A
11	9606.ENSP00000261601	0.574	Ubiquitin carboxyl-terminal hydrolase 14
12	9606.ENSP00000083182	0.570	Amyloid protein-binding protein 2
13	9606.ENSP00000357545	0.563	Protein FAM162B
14	9606.ENSP00000311528	0.562	Probable G-protein coupled receptor 162
15	9606.ENSP00000265239	0.556	IQ domain-containing protein G
16	9606.ENSP00000368835	0.554	Protein yippee-like 5
17	9606.ENSP00000343535	0.553	Ubiquitin carboxyl-terminal hydrolase 7
18	9606.ENSP00000349437	0.553	Cation-independent mannose-6-phosphate receptor
19	9606.ENSP00000229268	0.552	Ubiquitin carboxyl-terminal hydrolase 5
20	9606.ENSP00000251241	0.551	Probable ATP-dependent RNA helicase DHX40

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0004197	0.548	cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0043412	0.995	macromolecule modification
GO:0070646	0.979	protein modification by small protein removal
GO:0016579	0.970	protein deubiquitination
GO:0065007	0.761	biological regulation
GO:0009987	0.724	cellular process
GO:0050789	0.697	regulation of biological process
GO:0050794	0.518	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005794	0.982	Golgi apparatus
GO:0070013	0.496	intracellular organelle lumen
GO:0005634	0.376	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.548	Cysteine endopeptidases.

[back to server]