StarFunc result for job id Q8NFA2

User Input

>input (376 residues)
MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKKTLKETFPVEA
GLLRRSDRVLPKLLGQASLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTI
TGFFAPQPLDLEPALPPGSRVILPTPEEQPLSRAAGRLSIHSLEAQSLRCLQPFCTQDTR
DRPFQAQAQESLDVLLRHPSGWWLVENEDRQTAWFPAPYLEEAAPGQGREGGPSLGSSGP
QFCASRAYESSRADELSVPAGARVRVLETSDRGWWLCRYGDRAGLLPAVLLRPEGLGALL
SGTGFRGGDDPAGEARGFPEPSQATAPPPTVPTRPSPGAIQSRCCTVTRRALERRPRRQG
RPRGCVDSVPHPTTEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFA2	1.000	1.000	8.951E-73	376	1.000	1.000	Q8NFA2.pdb.gz	NOXO1_HUMAN NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1 PE=1 SV=1
2	AFDB:Q8VCM2	0.684	0.729	1.762E-49	349	0.641	0.691	Q8VCM2.pdb.gz	NOXO1_MOUSE NADPH oxidase organizer 1 OS=Mus musculus OX=10090 GN=Noxo1 PE=2 SV=2
3	AFDB:B5X4S7	0.345	0.316	2.270E-23	413	0.229	0.208	B5X4S7.pdb.gz	B5X4S7_SALSA Neutrophil cytosol factor 1 OS=Salmo salar OX=8030 GN=SPD2A PE=2 SV=1
4	AFDB:A2BFP2	0.330	0.304	1.862E-22	410	0.253	0.232	A2BFP2.pdb.gz
5	AFDB:Q5TCZ1	0.302	0.105	2.856E-21	1133	0.231	0.077	Q5TCZ1.pdb.gz	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
6	AFDB:A1X283	0.304	0.129	1.763E-20	911	0.221	0.091	A1X283.pdb.gz	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
7	AFDB:Q1LYG0	0.297	0.103	7.308E-20	1119	0.234	0.079	Q1LYG0.pdb.gz	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
8	AFDB:A2AAY5	0.304	0.130	1.028E-19	908	0.213	0.088	A2AAY5.pdb.gz	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
9	AFDB:O94868	0.157	0.084	3.948E-10	740	0.168	0.085	O94868.pdb.gz	FCSD2_HUMAN F-BAR and double SH3 domains protein 2 OS=Homo sapiens OX=9606 GN=FCHSD2 PE=1 SV=3
10	AFDB:Q6PFY1	0.154	0.087	1.637E-9	688	0.197	0.108	Q6PFY1.pdb.gz	FCSD1_MOUSE F-BAR and double SH3 domains protein 1 OS=Mus musculus OX=10090 GN=Fchsd1 PE=1 SV=1
11	PDB:2dybA	0.270	0.336	3.027E-8	298	0.122	0.154	2dybA.pdb.gz
12	PDB:2lqnA	0.145	0.176	5.669E-6	303	0.096	0.119	2lqnA.pdb.gz
13	PDB:2eyzA	0.223	0.265	1.409E-5	304	0.093	0.115	2eyzA.pdb.gz
14	PDB:1griA	0.149	0.262	7.550E-4	211	0.080	0.142	1griA.pdb.gz
15	PDB:3ehqA	0.134	0.269	4.933E-3	182	0.040	0.082	3ehqA.pdb.gz
16	PDB:1ocuA	0.231	0.574	5.221E-3	134	0.056	0.157	1ocuA.pdb.gz	Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
17	PDB:1k9aB	0.139	0.119	6.193E-3	441	0.032	0.027	1k9aB.pdb.gz
18	PDB:2h8hA	0.136	0.115	7.775E-3	445	0.040	0.034	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:3qwyA	0.142	0.306	8.712E-3	170	0.053	0.118	3qwyA.pdb.gz
20	PDB:2mxcA	0.205	0.408	1.094E-2	172	0.069	0.151	2mxcA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NFA2	0.0	739	376	1.000	1.000	NOXO1_HUMAN NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1 PE=1 SV=1
2	Q8VCM2	8.77e-162	459	349	0.636	0.685	NOXO1_MOUSE NADPH oxidase organizer 1 OS=Mus musculus OX=10090 GN=Noxo1 PE=2 SV=2
3	F1M707	4.91e-27	112	389	0.202	0.195	NCF1_RAT Neutrophil cytosolic factor 1 OS=Rattus norvegicus OX=10116 GN=Ncf1 PE=1 SV=2
4	Q4Z8P3	8.40e-27	112	410	0.239	0.220	Q4Z8P3_DANRE Neutrophil cytosol factor 1 OS=Danio rerio OX=7955 GN=cb893 PE=2 SV=1
5	Q09014	6.88e-26	109	390	0.199	0.192	NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus OX=10090 GN=Ncf1 PE=1 SV=3
6	P14598	6.45e-25	106	390	0.247	0.238	NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens OX=9606 GN=NCF1 PE=1 SV=4
7	B5X4S7	1.41e-23	103	413	0.184	0.167	B5X4S7_SALSA Neutrophil cytosol factor 1 OS=Salmo salar OX=8030 GN=SPD2A PE=2 SV=1
8	B8YQ98	3.95e-23	102	413	0.184	0.167	B8YQ98_SALSA NADPH oxidase cytosolic protein OS=Salmo salar OX=8030 GN=p47phox PE=2 SV=1
9	Q1LYG0	2.57e-19	92.0	1119	0.186	0.063	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
10	O89032	7.18e-18	87.8	1124	0.197	0.066	SPD2A_MOUSE SH3 and PX domain-containing protein 2A OS=Mus musculus OX=10090 GN=Sh3pxd2a PE=1 SV=2
11	Q5TCZ1	7.88e-18	87.8	1133	0.197	0.065	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
12	A1X283	8.77e-18	87.4	911	0.170	0.070	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
13	A2AAY5	9.10e-17	84.3	908	0.170	0.070	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
14	Q9Z0R4	1.91e-06	52.4	1714	0.080	0.018	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
15	Q9WVE9	2.30e-06	52.4	1713	0.080	0.018	ITSN1_RAT Intersectin-1 OS=Rattus norvegicus OX=10116 GN=Itsn1 PE=1 SV=2
16	A9P3U3	4.89e-06	50.8	774	0.098	0.048	A9P3U3_EMEND AbpA OS=Emericella nidulans OX=162425 GN=abpA PE=4 SV=1
17	Q15811	8.28e-06	50.4	1721	0.074	0.016	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
18	F8W7U0	9.55e-06	50.1	1149	0.085	0.028	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1
19	Q62662	4.07e-05	47.8	506	0.056	0.042	FRK_RAT Tyrosine-protein kinase FRK OS=Rattus norvegicus OX=10116 GN=Frk PE=1 SV=3
20	A8WFV6	6.05e-05	47.4	537	0.066	0.047	A8WFV6_DANRE Nostrin OS=Danio rerio OX=7955 GN=nostrin PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00787 PX	2.8	20.0	PX domain
2	PF00018 SH3_1	1.7e-09	48.5	SH3 domain
3	PF07653 SH3_2	0.031	25.4	Variant SH3 domain
4	PF08239 SH3_3	90	14.9	Bacterial SH3 domain
5	PF14604 SH3_9	1.3e-08	46.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380450

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261623	0.999	Cytochrome b-245 light chain
2	9606.ENSP00000342848	0.999	NADPH oxidase activator 1
3	9606.ENSP00000362057	0.999	NADPH oxidase 1
4	9606.ENSP00000356505	0.978	Neutrophil cytosol factor 2
5	9606.ENSP00000380334	0.968	Neutrophil cytosol factor 4
6	9606.ENSP00000348461	0.950	Ras-related C3 botulinum toxin substrate 1
7	9606.ENSP00000367851	0.943	Cytochrome b-245 heavy chain
8	9606.ENSP00000159060	0.923	NADPH oxidase 3
9	9606.ENSP00000373518	0.914	NADPH oxidase 5
10	9606.ENSP00000263317	0.895	NADPH oxidase 4
11	9606.ENSP00000317997	0.891	Dual oxidase 1
12	9606.ENSP00000475084	0.845	Dual oxidase 2
13	9606.ENSP00000376345	0.824	Growth factor receptor-bound protein 2
14	9606.ENSP00000289473	0.807	Neutrophil cytosol factor 1
15	9606.ENSP00000267803	0.706	Dual oxidase maturation factor 1
16	9606.ENSP00000475924	0.706	DNA polymerase delta interacting protein 2
17	9606.ENSP00000319705	0.683	Dual oxidase maturation factor 2
18	9606.ENSP00000005340	0.600	Segment polarity protein dishevelled homolog DVL-2
19	9606.ENSP00000264634	0.600	Protein Wnt-5a
20	9606.ENSP00000286201	0.600	Frizzled-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005543	1.000	phospholipid binding
GO:0008047	1.000	enzyme activator activity
GO:0019899	0.923	enzyme binding
GO:0016176	0.683	superoxide-generating NADPH oxidase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0031323	0.987	regulation of cellular metabolic process
GO:2000377	0.983	regulation of reactive oxygen species metabolic process
GO:0016043	0.905	cellular component organization
GO:0010310	0.898	regulation of hydrogen peroxide metabolic process
GO:0008152	0.840	metabolic process
GO:0043062	0.806	extracellular structure organization
GO:0045229	0.796	external encapsulating structure organization
GO:0044237	0.721	cellular metabolic process
GO:0022411	0.655	cellular component disassembly
GO:0022617	0.631	extracellular matrix disassembly
GO:0050896	0.525	response to stimulus
GO:0072593	0.498	reactive oxygen species metabolic process
GO:0006801	0.472	superoxide metabolic process
GO:0048518	0.337	positive regulation of biological process
GO:0048522	0.318	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:1990204	0.988	oxidoreductase complex
GO:0098797	0.988	plasma membrane protein complex
GO:0005737	0.970	cytoplasm
GO:0005829	0.923	cytosol
GO:0012505	0.879	endomembrane system
GO:0031982	0.864	vesicle
GO:0043229	0.846	intracellular organelle
GO:0043231	0.839	intracellular membrane-bounded organelle
GO:0043020	0.415	NADPH oxidase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]