StarFunc result for job id Q8NFC6

User Input

>input (1400 residues)
MATNPQPQPPPPAPPPPPPQPQPQPPPPPPGPGAGPGAGGAGGAGAGAGDPQLVAMIVNH
LKSQGLFDQFRRDCLADVDTKPAYQNLRQRVDNFVANHLATHTWSPHLNKNQLRNNIRQQ
VLKSGMLESGIDRIISQVVDPKINHTFRPQVEKAVHEFLATLNHKEEGSGNTAPDDEKPD
TSLITQGVPTPGPSANVANDAMSILETITSLNQEASAARASTETSNAKTSERASKKLPSQ
PTTDTSTDKERTSEDMADKEKSTADSGGEGLETAPKSEEFSDLPCPVEEIKNYTKEHNNL
ILLNKDVQQESSEQKNKSTDKGEKKPDSNEKGERKKEKKEKTEKKFDHSKKSEDTQKVKD
EKQAKEKEVESLKLPSEKNSNKAKTVEGTKEDFSLIDSDVDGLTDITVSSVHTSDLSSFE
EDTEEEVVTSDSMEEGEITSDDEEKNKQNKTKTQTSDSSEGKTKSVRHAYVHKPYLYSKY
YSDSDDELTVEQRRQSIAKEKEERLLRRQINREKLEEKRKQKAEKTKSSKTKGQGRSSVD
LEESSTKSLEPKAARIKEVLKERKVLEKKVALSKKRKKDSRNVEENSKKKQQYEEDSKET
LKTSEHCEKEKISSSKELKHVHAKSEPSKPARRLSESLHVVDENKNESKLEREHKRRTST
PVIMEGVQEETDTRDVKRQVERSEICTEEPQKQKSTLKNEKHLKKDDSETPHLKSLLKKE
VKSSKEKPEREKTPSEDKLSVKHKYKGDCMHKTGDETELHSSEKGLKVEENIQKQSQQTK
LSSDDKTERKSKHRNERKLSVLGKDGKPVSEYIIKTDENVRKENNKKERRLSAEKTKAEH
KSRRSSDSKIQKDSLGSKQHGITLQRRSESYSEDKCDMDSTNMDSNLKPEEVVHKEKRRT
KSLLEEKLVLKSKSKTQGKQVKVVETELQEGATKQATTPKPDKEKNTEENDSEKQRKSKV
EDKPFEETGVEPVLETASSSAHSTQKDSSHRAKLPLAKEKYKSDKDSTSTRLERKLSDGH
KSRSLKHSSKDIKKKDENKSDDKDGKEVDSSHEKARGNSSLMEKKLSRRLCENRRGSLSQ
EMAKGEEKLAANTLSTPSGSSLQRPKKSGDMTLIPEQEPMEIDSEPGVENVFEVSKTQDN
RNNNSQQDIDSENMKQKTSATVQKDELRTCTADSKATAPAYKPGRGTGVNSNSEKHADHR
STLTKKMHIQSAVSKMNPGEKEPIHRGTTEVNIDSETVHRMLLSAPSENDRVQKNLKNTA
AEEHVAQGDATLEHSTNLDSSPSLSSVTVVPLRESYDPDVIPLFDKRTVLEGSTASTSPA
DHSALPNQSLTVRESEVLKTSDSKEGGEGFTVDTPAKASITSKRHIPEAHQATLLDGKQG
KVIMPLGSKLTGVIVENENI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F4I1T7	0.041	0.034	7.146E-10	1819	0.133	0.102	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
2	AFDB:Q6P5H2	0.035	0.029	1.577E-8	1864	0.169	0.127	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
3	AFDB:E9PV87	0.039	0.037	5.576E-7	1520	0.151	0.139	E9PV87.pdb.gz	TALD3_MOUSE Protein TALPID3 OS=Mus musculus OX=10090 GN=Talpid3 PE=1 SV=1
4	AFDB:P23226	0.040	0.043	1.169E-6	1185	0.127	0.150	P23226.pdb.gz	MA205_DROME 205 kDa microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=Map205 PE=1 SV=2
5	AFDB:P21263	0.042	0.034	1.337E-6	1893	0.159	0.117	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
6	AFDB:Q9BVV6	0.043	0.039	1.750E-6	1533	0.143	0.130	Q9BVV6.pdb.gz	TALD3_HUMAN Protein TALPID3 OS=Homo sapiens OX=9606 GN=KIAA0586 PE=1 SV=4
7	AFDB:Q9Z1Q1	0.033	0.028	4.487E-6	1818	0.150	0.116	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
8	AFDB:Q70IV5	0.045	0.041	3.862E-5	1561	0.142	0.127	Q70IV5.pdb.gz	SYNEM_MOUSE Synemin OS=Mus musculus OX=10090 GN=Synm PE=1 SV=2
9	AFDB:O00512	0.046	0.045	7.076E-5	1426	0.128	0.126	O00512.pdb.gz	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4
10	AFDB:M9PHT1	0.046	0.035	2.540E-4	2007	0.141	0.099	M9PHT1.pdb.gz	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
11	PDB:7vvuV	0.046	0.213	2.016E-1	113	0.009	0.115	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
12	PDB:4n78F	0.034	0.181	3.951E-1	156	0.014	0.122	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
13	PDB:5bw9g	0.050	0.217	4.835E-1	141	0.011	0.106	5bw9g.pdb.gz
14	PDB:4wa6B	0.045	0.373	7.239E-1	96	0.014	0.208	4wa6B.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
15	PDB:1u2mC	0.052	0.342	8.857E-1	143	0.005	0.049	1u2mC.pdb.gz
16	PDB:6so5C	0.051	0.301	1.013	144	0.010	0.097	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
17	PDB:7qcdF	0.041	0.135	1.159	257	0.013	0.070	7qcdF.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
18	PDB:6d7lA	0.033	0.113	1.517	288	0.008	0.038	6d7lA.pdb.gz
19	PDB:6lqsBE	0.029	0.043	1.736	823	0.015	0.026	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
20	PDB:4ke2A	0.035	0.159	1.856	196	0.010	0.071	4ke2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NFC6	0.0	2826	3051	1.000	0.459	BD1L1_HUMAN Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2
2	Q96IK1	5.54e-58	200	185	0.060	0.454	BOD1_HUMAN Biorientation of chromosomes in cell division protein 1 OS=Homo sapiens OX=9606 GN=BOD1 PE=1 SV=2
3	Q8IYS8	7.41e-49	173	172	0.056	0.453	BD1L2_HUMAN Biorientation of chromosomes in cell division protein 1-like 2 OS=Homo sapiens OX=9606 GN=BOD1L2 PE=1 SV=2
4	Q9VAY4	5.46e-27	122	1109	0.035	0.044	Q9VAY4_DROME Biorientation defective 1, isoform A OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=2
5	A0A0B4KHZ9	6.53e-27	122	1151	0.035	0.043	A0A0B4KHZ9_DROME Biorientation defective 1, isoform E OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1
6	Q8IMM6	6.53e-27	122	1150	0.035	0.043	Q8IMM6_DROME Biorientation defective 1, isoform B OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05205 COMPASS-Shg1	4.5e-19	80.4	COMPASS (Complex proteins associated with Set1p) component shg1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000040738

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000390475	0.865	CXXC-type zinc finger protein 1
2	9606.ENSP00000262519	0.801	Histone-lysine N-methyltransferase SETD1A
3	9606.ENSP00000298492	0.761	BRISC complex subunit Abraxas 2
4	9606.ENSP00000313983	0.751	Histone-lysine N-methyltransferase NSD3
5	9606.ENSP00000307208	0.726	Nucleosome-remodeling factor subunit BPTF
6	9606.ENSP00000351185	0.717	DNA replication ATP-dependent helicase/nuclease DNA2
7	9606.ENSP00000351446	0.697	WD repeat-containing protein 5
8	9606.ENSP00000299432	0.683	Putative protein MSS51 homolog, mitochondrial
9	9606.ENSP00000258888	0.681	Alpha-protein kinase 3
10	9606.ENSP00000357475	0.676	Phospholipid-transporting ATPase ID
11	9606.ENSP00000370150	0.674	ATPase WRNIP1
12	9606.ENSP00000355506	0.673	Exonuclease 1
13	9606.ENSP00000312143	0.672	Tensin-3
14	9606.ENSP00000369335	0.661	F-box DNA helicase 1
15	9606.ENSP00000376522	0.642	Centrosomal protein 112
16	9606.ENSP00000423505	0.642	Tetratricopeptide repeat domain containing
17	9606.ENSP00000349823	0.629	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
18	9606.ENSP00000361628	0.629	RPA-related protein RADX
19	9606.ENSP00000382863	0.621	Chromodomain-helicase-DNA-binding protein 8
20	9606.ENSP00000369497	0.616	Breast cancer type 2 susceptibility protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006261	0.992	DNA-templated DNA replication
GO:0006974	0.991	cellular response to DNA damage stimulus
GO:0031297	0.956	replication fork processing
GO:0065007	0.342	biological regulation
GO:0050789	0.313	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0035097	0.995	histone methyltransferase complex
GO:0048188	0.993	Set1C/COMPASS complex
GO:0005737	0.613	cytoplasm
GO:0005829	0.361	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]