StarFunc result for job id Q8NFD5

User Input

>input (2236 residues)
MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAME
TGLLPNHKLKTVGEAPAAPPHQQHHHHHHAHHHHHHAHHLHHHHALQQQLNQFQQQQQQQ
QQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLS
KPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPA
SGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAAGAPGSMDPLQNSHEGYPNSQCNHYPG
YSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGG
SSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLN
QLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQAAAAGAAAGGQQAAAGMGLGKDMG
AQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQ
QSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQMPPQYGQQGVSGYCQQGQQPY
YSQQPQPPHLPPQAQYLPSQSQQRYQPQQDMSQEGYGTRSQPPLAPGKPNHEDLNLIQQE
RPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPG
GPSPSPVGSPVGSNQSRSGPISPASIPGSQMPPQPPGSQSESSSHPALSQSPMPQERGFM
AGTQRNPQMAQYGPQQTGPSMSPHPSPGGQMHAGISSFQQSNSSGTYGPQMSQYGPQGNY
SRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNM
SSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSRQGSFPGMNQSGLM
ASSSPYSQPMNNSSSLMNTQAPPYSMAPAMVNSSAASVGLADMMSPGESKLPLPLKADGK
EEGTPQPESKSKKSSSSTTTGEKITKVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAV
GKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFE
CKIERGEEPPPEVFSTGDTKKQPKLQPPSPANSGSLQGPQTPQSTGSNSMAEVPGDLKPP
TPASTPHGQMTPMQGGRSSTISVHDPFSDVSDSSFPKRNSMTPNAPYQQGMSMPDVMGRM
PYEPNKDPFGGMRKVPGSSEPFMTQGQMPNSSMQDMYNQSPSGAMSNLGMGQRQQFPYGA
SYDRRHEPYGQQYPGQGPPSGQPPYGGHQPGLYPQQPNYKRHMDGMYGPPAKRHEGDMYN
MQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQ
SSSSEGPQQNMWAARNDMPYPYQNRQGPGGPTQAPPYPGMNRTDDMMVPDQRINHESQWP
SHVSQRQPYMSSSASMQPITRPPQPSYQTPPSLPNHISRAPSPASFQRSLENRMSPSKSP
FLPSMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPVLKQRRKITSKDIVT
PEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLID
IFGILMEYEVGDPSQKALDHNAARKDDSQSLADDSGKEEEDAECIDDDEEDEEDEEEDSE
KTESDEKSSIALTAPDAAADPKEKPKQASKFDKLPIKIVKKNNLFVVDRSDKLGRVQEFN
SGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPLSSAGRKKEQEGKGDSEEQQEKSI
IATIDDVLSARPGALPEDANPGPQTESSKFPFGIQQAKSHRNIKLLEDEPRSRDETPLCT
IAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQ
TYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLL
HWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYA
TLVRYVGDRKNPVCREMSMALLSNLAQGDALAARAIAVQKGSIGNLISFLEDGVTMAQYQ
QSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDISISAVLNS
LVASVICDVLFQIGQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFD5	1.000	1.000	0.000	2236	1.000	1.000	Q8NFD5.pdb.gz	ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=3
2	PDB:6lthL	0.205	0.978	2.728E-48	466	0.167	0.803	6lthL.pdb.gz	Structure of nucleosome-bound human BAF complex.
3	AFDB:Q9Y2F5	0.060	0.060	1.093E-4	2266	0.135	0.133	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
4	AFDB:Q9W517	0.115	0.141	2.576E-4	1741	0.098	0.126	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
5	PDB:6hb3B	0.094	0.466	3.650E-4	360	0.015	0.094	6hb3B.pdb.gz
6	PDB:2z6gA	0.087	0.277	6.371E-4	550	0.024	0.098	2z6gA.pdb.gz
7	PDB:7anwA	0.074	0.220	7.893E-4	645	0.018	0.064	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
8	PDB:6kbnC	0.089	0.354	9.779E-4	504	0.017	0.075	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
9	PDB:7c4jI	0.130	0.480	1.161E-3	524	0.030	0.130	7c4jI.pdb.gz
10	AFDB:Q5H9R4	0.087	0.085	2.195E-3	2290	0.139	0.135	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
11	PDB:4hm9A	0.076	0.280	2.735E-3	511	0.014	0.061	4hm9A.pdb.gz
12	PDB:7unkA	0.083	0.153	3.854E-3	1047	0.021	0.045	7unkA.pdb.gz
13	PDB:5tbkA	0.070	0.245	4.574E-3	417	0.016	0.084	5tbkA.pdb.gz
14	PDB:7cm7A	0.073	0.221	4.983E-3	620	0.019	0.068	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
15	AFDB:O43432	0.051	0.065	5.173E-3	1585	0.091	0.129	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
16	AFDB:Q9VCH1	0.053	0.056	7.607E-3	2072	0.147	0.159	Q9VCH1.pdb.gz	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
17	AFDB:Q02952	0.036	0.041	9.029E-3	1782	0.104	0.131	Q02952.pdb.gz	AKA12_HUMAN A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4
18	AFDB:Q9VZ85	0.036	0.038	1.027E-2	1984	0.115	0.130	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
19	AFDB:X2JEI9	0.035	0.036	1.645E-2	2206	0.124	0.126	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
20	AFDB:E7F958	0.028	0.035	1.717E-2	1715	0.100	0.130	E7F958.pdb.gz	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVD3	0.0	3163	2375	0.766	0.721	A0A0G2JVD3_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=1
2	A0A1B0GTJ8	0.0	2645	1495	0.622	0.930	A0A1B0GTJ8_HUMAN AT-rich interaction domain 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2
3	A0A1B0GTU5	0.0	1733	1903	0.454	0.534	A0A1B0GTU5_HUMAN AT-rich interaction domain 1A (Fragment) OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=1
4	A0A1B0GV63	0.0	2656	1349	0.580	0.961	A0A1B0GV63_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
5	A0A1B0GVK1	0.0	3034	1539	0.665	0.966	A0A1B0GVK1_HUMAN AT-rich interaction domain 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
6	A0A1B0GWJ2	0.0	2863	1479	0.626	0.946	A0A1B0GWJ2_HUMAN AT-rich interaction domain 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
7	A0A1B0GWZ0	0.0	2974	1864	0.732	0.878	A0A1B0GWZ0_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=2
8	A0A3F2YNW7	0.0	4499	2332	1.000	0.959	A0A3F2YNW7_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
9	A2BH40	0.0	1760	2283	0.453	0.444	ARI1A_MOUSE AT-rich interactive domain-containing protein 1A OS=Mus musculus OX=10090 GN=Arid1a PE=1 SV=1
10	F1LNP1	0.0	2974	1763	0.709	0.900	F1LNP1_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=3
11	H0Y2R3	0.0	980	727	0.261	0.802	H0Y2R3_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2
12	H0Y488	0.0	1733	1901	0.454	0.534	H0Y488_HUMAN AT-rich interaction domain 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=2
13	H0Y7H8	0.0	3442	1758	0.763	0.970	H0Y7H8_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
14	O14497	0.0	1731	2285	0.454	0.444	ARI1A_HUMAN AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3
15	Q8NFD5	0.0	4507	2319	1.000	0.964	ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=3
16	Q8IN94	2.74e-87	322	2716	0.072	0.059	OSA_DROME Trithorax group protein osa OS=Drosophila melanogaster OX=7227 GN=osa PE=1 SV=1
17	E9Q4N7	1.60e-61	237	2306	0.102	0.098	ARI1B_MOUSE AT-rich interactive domain-containing protein 1B OS=Mus musculus OX=10090 GN=Arid1b PE=1 SV=2
18	Q62431	1.18e-24	114	601	0.024	0.088	ARI3A_MOUSE AT-rich interactive domain-containing protein 3A OS=Mus musculus OX=10090 GN=Arid3a PE=1 SV=1
19	Q99856	1.78e-24	113	593	0.024	0.089	ARI3A_HUMAN AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2
20	Q8IVW6	1.28e-22	107	561	0.020	0.080	ARI3B_HUMAN AT-rich interactive domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ARID3B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	7.2e-14	63.6	ARID/BRIGHT DNA binding domain
2	PF12031 BAF250_C	1e-119	410.1	SWI/SNF-like complex subunit BAF250/Osa

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344546

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000395654	0.999	Transcription activator BRG1
2	9606.ENSP00000254480	0.998	SWI/SNF complex subunit SMARCC1
3	9606.ENSP00000263121	0.998	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
4	9606.ENSP00000265773	0.998	Probable global transcription activator SNF2L2
5	9606.ENSP00000267064	0.998	SWI/SNF complex subunit SMARCC2
6	9606.ENSP00000323967	0.997	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
7	9606.ENSP00000378414	0.997	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
8	9606.ENSP00000397552	0.995	Actin-like protein 6A
9	9606.ENSP00000414516	0.994	Protein SSXT
10	9606.ENSP00000262188	0.993	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
11	9606.ENSP00000479526	0.992	Zinc finger protein DPF3
12	9606.ENSP00000392617	0.989	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
13	9606.ENSP00000320485	0.988	AT-rich interactive domain-containing protein 1A
14	9606.ENSP00000436901	0.986	Zinc finger protein ubi-d4
15	9606.ENSP00000310275	0.983	Barrier-to-autointegration factor
16	9606.ENSP00000419765	0.957	Bromodomain-containing protein 9
17	9606.ENSP00000313933	0.945	BRD4-interacting chromatin-remodeling complex-associated protein-like
18	9606.ENSP00000378307	0.943	Protein polybromo-1
19	9606.ENSP00000379946	0.940	BRD4-interacting chromatin-remodeling complex-associated protein
20	9606.ENSP00000445868	0.929	B-cell CLL/lymphoma 7 protein family member A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.996	DNA binding
GO:0140110	0.732	transcription regulator activity
GO:0003700	0.447	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050896	0.956	response to stimulus
GO:0051716	0.930	cellular response to stimulus
GO:0050794	0.918	regulation of cellular process
GO:0019222	0.890	regulation of metabolic process
GO:0060255	0.884	regulation of macromolecule metabolic process
GO:0010468	0.867	regulation of gene expression
GO:0048518	0.851	positive regulation of biological process
GO:0010604	0.829	positive regulation of macromolecule metabolic process
GO:0031326	0.827	regulation of cellular biosynthetic process
GO:0010556	0.826	regulation of macromolecule biosynthetic process
GO:0051252	0.825	regulation of RNA metabolic process
GO:1903506	0.817	regulation of nucleic acid-templated transcription
GO:0006355	0.812	regulation of DNA-templated transcription
GO:0048522	0.782	positive regulation of cellular process
GO:0051173	0.762	positive regulation of nitrogen compound metabolic process
GO:0031325	0.756	positive regulation of cellular metabolic process
GO:0006325	0.720	chromatin organization
GO:0006338	0.704	chromatin remodeling
GO:0045935	0.687	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.667	positive regulation of macromolecule biosynthetic process
GO:0031328	0.667	positive regulation of cellular biosynthetic process
GO:0051254	0.666	positive regulation of RNA metabolic process
GO:0045893	0.658	positive regulation of DNA-templated transcription
GO:0006950	0.488	response to stress
GO:0071495	0.488	cellular response to endogenous stimulus
GO:0042221	0.469	response to chemical
GO:0009725	0.461	response to hormone
GO:0071310	0.460	cellular response to organic substance
GO:0032501	0.443	multicellular organismal process
GO:0032502	0.442	developmental process
GO:0048856	0.430	anatomical structure development
GO:0006357	0.369	regulation of transcription by RNA polymerase II
GO:0032870	0.364	cellular response to hormone stimulus
GO:0007275	0.355	multicellular organism development
GO:0071375	0.344	cellular response to peptide hormone stimulus
GO:0023052	0.305	signaling
GO:0007154	0.305	cell communication
GO:0048519	0.300	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.999	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0016020	0.986	membrane
GO:0005829	0.985	cytosol
GO:0070603	0.977	SWI/SNF superfamily-type complex
GO:0005886	0.958	plasma membrane
GO:0016514	0.838	SWI/SNF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]