StarFunc result for job id Q8NFF5

User Input

>input (587 residues)
MGWDLGTRLFQRQEQRSRLSRIWLEKTRVFLEGSTRTPALPHCLFWLLQVPSTQDPLFPG
YGPQCPVDLAGPPCLRPLFGGLGGYWRALQRGREGRTMTSRASELSPGRSVTAGIIIVGD
EILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIG
PTHDDVTFEAVAQAFGDELKPHPKLEAATKALGGEGWEKLSLVPSSARLHYGTDPCTGQP
FRFPLVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEA
QAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVE
QASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAV
QRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQ
LEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILY
DRGYTSLGSRENTVRNPALKCLSPGGHPTYRPAYLLENEEEERNSRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFF5	1.000	1.000	0.000	587	1.000	1.000	Q8NFF5.pdb.gz	FAD1_HUMAN FAD synthase OS=Homo sapiens OX=9606 GN=FLAD1 PE=1 SV=1
2	AFDB:O74841	0.368	0.800	1.198E-23	265	0.145	0.321	O74841.pdb.gz	FAD1_SCHPO Probable FAD synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1235.04c PE=3 SV=1
3	AFDB:Q03219	0.378	0.784	5.869E-20	274	0.099	0.212	Q03219.pdb.gz	YM44_YEAST Uncharacterized protein YMR178W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR178W PE=1 SV=1
4	AFDB:P9WPE3	0.383	0.500	5.055E-19	430	0.155	0.212	P9WPE3.pdb.gz	CINAL_MYCTU CinA-like protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cinA PE=1 SV=1
5	AFDB:Q6FNA9	0.353	0.659	1.928E-18	304	0.129	0.250	Q6FNA9.pdb.gz	Q6FNA9_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=FMNAT PE=1 SV=1
6	AFDB:Q384S3	0.324	0.577	2.221E-17	322	0.099	0.180	Q384S3.pdb.gz	Q384S3_TRYB2 Phosphoadenosine phosphosulfate reductase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5320 PE=4 SV=1
7	PDB:3g5aB	0.353	0.659	2.735E-17	305	0.128	0.246	3g5aB.pdb.gz	Structure and mechanism of a eukaryotic FMN adenylyltransferase.
8	AFDB:P38913	0.343	0.637	2.971E-17	306	0.129	0.248	P38913.pdb.gz	FAD1_YEAST Flavin adenine dinucleotide synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAD1 PE=1 SV=1
9	PDB:2wsiA	0.351	0.694	1.316E-16	285	0.129	0.267	2wsiA.pdb.gz	Crystal Structure of Yeast Fad Synthetase (Fad1) in Complex with Fad.
10	PDB:2goyB	0.260	0.641	1.810E-8	223	0.072	0.188	2goyB.pdb.gz	Substrate Recognition, Protein Dynamics, and Iron-Sulfur Cluster in Pseudomonas aeruginosa Adenosine 5'-Phosphosulfate Reductase.
11	PDB:1zunA	0.255	0.688	2.883E-8	204	0.065	0.186	1zunA.pdb.gz	Molecular basis for g protein control of the prokaryotic ATP sulfurylase.
12	PDB:2oq2C	0.272	0.598	4.088E-8	257	0.075	0.171	2oq2C.pdb.gz	Crystal structure of Saccharomyces cerevisiae 3'-phosphoadenosine-5'-phosphosulfate reductase complexed with adenosine 3',5'-bisphosphate.
13	PDB:1gpmA	0.201	0.233	3.521E-7	501	0.097	0.114	1gpmA.pdb.gz	The crystal structure of GMP synthetase reveals a novel catalytic triad and is a structural paradigm for two enzyme families.
14	PDB:7lhrA	0.230	0.599	2.018E-6	214	0.070	0.192	7lhrA.pdb.gz	Crystal Structure of the [4Fe-4S] Cluster-Containing Adenosine-5'-phosphosulfate Reductase from Mycobacterium tuberculosis .
15	PDB:1ni5A	0.192	0.255	2.699E-6	433	0.051	0.069	1ni5A.pdb.gz
16	AFDB:O53897	0.193	0.528	2.932E-6	181	0.053	0.171	O53897.pdb.gz	O53897_MYCTU MoaB/Mog domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moaB2 PE=1 SV=3
17	PDB:2o8vA	0.233	0.560	3.406E-6	229	0.066	0.170	2o8vA.pdb.gz
18	PDB:2vxoB	0.196	0.176	2.612E-5	658	0.089	0.079	2vxoB.pdb.gz	Substrate Specificity and Oligomerization of Human Gmp Synthetase
19	AFDB:O33230	0.134	0.152	3.084E-4	495	0.089	0.105	O33230.pdb.gz	O33230_MYCTU GTPase HflX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hflX PE=1 SV=1
20	AFDB:Q1KPV0	0.109	0.079	3.269E-4	912	0.107	0.069	Q1KPV0.pdb.gz	FZL_ARATH Probable transmembrane GTPase FZO-like, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FZL PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T196	0.0	932	456	0.777	1.000	Q5T196_HUMAN Fad1, flavin adenine dinucleotide synthetase, homolog (Yeast), isoform CRA_e OS=Homo sapiens OX=9606 GN=FLAD1 PE=1 SV=1
2	Q8NFF5	0.0	1207	587	1.000	1.000	FAD1_HUMAN FAD synthase OS=Homo sapiens OX=9606 GN=FLAD1 PE=1 SV=1
3	O74841	1.40e-45	164	265	0.148	0.328	FAD1_SCHPO Probable FAD synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1235.04c PE=3 SV=1
4	P38913	7.69e-25	107	306	0.128	0.245	FAD1_YEAST Flavin adenine dinucleotide synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAD1 PE=1 SV=1
5	Q6FNA9	1.10e-23	103	304	0.109	0.211	Q6FNA9_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=FMNAT PE=1 SV=1
6	Q384S3	1.52e-20	95.1	322	0.095	0.174	Q384S3_TRYB2 Phosphoadenosine phosphosulfate reductase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5320 PE=4 SV=1
7	Q03219	1.03e-19	91.7	274	0.118	0.252	YM44_YEAST Uncharacterized protein YMR178W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR178W PE=1 SV=1
8	P9WPE3	1.96e-10	65.5	430	0.063	0.086	CINAL_MYCTU CinA-like protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cinA PE=1 SV=1
9	P56859	7.76e-06	50.4	306	0.065	0.124	MET16_EMENI Phosphoadenosine phosphosulfate reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sA PE=3 SV=3
10	P92979	9.85e-05	47.4	465	0.087	0.110	APR1_ARATH 5'-adenylylsulfate reductase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APR1 PE=1 SV=2
11	P92980	0.001	43.9	458	0.043	0.055	APR3_ARATH 5'-adenylylsulfate reductase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APR3 PE=2 SV=2
12	P92981	0.003	43.1	454	0.049	0.064	APR2_ARATH 5'-adenylylsulfate reductase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APR2 PE=1 SV=2
13	P18408	0.004	41.6	261	0.037	0.084	MET16_YEAST Phosphoadenosine phosphosulfate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET16 PE=1 SV=2
14	Q9SDP3	0.009	41.2	442	0.046	0.061	Q9SDP3_ALLCE APS-reductase OS=Allium cepa OX=4679 PE=1 SV=1
15	P17854	0.015	40.0	244	0.044	0.107	CYSH_ECOLI Phosphoadenosine 5'-phosphosulfate reductase OS=Escherichia coli (strain K12) OX=83333 GN=cysH PE=1 SV=3
16	O05927	0.025	39.3	267	0.026	0.056	CYSH_PSEAE Adenosine 5'-phosphosulfate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cysH PE=1 SV=2
17	Q10270	0.040	38.5	266	0.036	0.079	MET16_SCHPO Probable phosphoadenosine phosphosulfate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=met16 PE=3 SV=1
18	Q6P980	0.57	35.0	224	0.037	0.098	Q6P980_DANRE Superoxide dismutase OS=Danio rerio OX=7955 GN=cb463 PE=1 SV=1
19	Q4KCD8	3.1	33.5	6675	0.075	0.007	Q4KCD8_PSEF5 Polyketide synthase/nonribosomal peptide synthetase hybrid RzxB OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=rzxB PE=1 SV=1
20	Q9VHI1	4.2	32.7	538	0.039	0.043	Q9VHI1_DROME Hyrax OS=Drosophila melanogaster OX=7227 GN=hyx PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00994 MoCF_biosynth	1.3e-23	94.7	Probable molybdopterin binding domain
2	PF01507 PAPS_reduct	5.5e-22	90.1	Phosphoadenosine phosphosulfate reductase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292180

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365926	0.995	Riboflavin kinase
2	9606.ENSP00000468767	0.903	Tartrate-resistant acid phosphatase type 5
3	9606.ENSP00000256997	0.902	Acid phosphatase 2, lysosomal
4	9606.ENSP00000406261	0.803	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
5	9606.ENSP00000354238	0.800	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
6	9606.ENSP00000297578	0.790	Mitochondrial folate transporter/carrier
7	9606.ENSP00000265174	0.780	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
8	9606.ENSP00000406157	0.780	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
9	9606.ENSP00000377681	0.742	Ras GTPase-activating protein-binding protein 1
10	9606.ENSP00000323424	0.737	Interferon-stimulated 20 kDa exonuclease-like 2
11	9606.ENSP00000262518	0.728	Helicase SRCAP
12	9606.ENSP00000426638	0.726	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
13	9606.ENSP00000217254	0.721	Solute carrier family 52, riboflavin transporter, member 3
14	9606.ENSP00000399979	0.721	Solute carrier family 52, riboflavin transporter, member 1
15	9606.ENSP00000339813	0.686	Protein-tyrosine sulfotransferase 2
16	9606.ENSP00000451261	0.686	Ubiquitin-conjugating enzyme E2 J1
17	9606.ENSP00000452762	0.657	Electron transfer flavoprotein subunit alpha, mitochondrial
18	9606.ENSP00000158771	0.654	Derlin-2
19	9606.ENSP00000377401	0.654	Adenosine 3'-phospho 5'-phosphosulfate transporter 1
20	9606.ENSP00000278840	0.651	Fatty acid desaturase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003919	1.000	FMN adenylyltransferase activity
GO:0016491	0.386	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0006767	0.982	water-soluble vitamin metabolic process
GO:1901564	0.976	organonitrogen compound metabolic process
GO:1901360	0.959	organic cyclic compound metabolic process
GO:0046483	0.955	heterocycle metabolic process
GO:0034641	0.942	cellular nitrogen compound metabolic process
GO:0044238	0.471	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.998	plasma membrane
GO:0043231	0.446	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17237	1.000	ATP + FMN + H(+) = diphosphate + FAD
EC:2.7.7.2	1.000	FAD synthase.
EC:1.-.-.-	0.386	Oxidoreductases.

[back to server]