StarFunc result for job id Q8NFG4

User Input

>input (579 residues)
MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRA
HSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSI
VRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRI
YLINSWPFLLGKVRGIIDELQGKALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARS
LTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTEDTLVQMEKLADLEEESESWD
NSEAEEEEKAPVLPESTEGRELTQGPAESSSLSGCGSWQPRKLPVFKSLRHMRQVLGAPS
FRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGL
SPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGP
TILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILG
ASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTASESRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q76JQ2	0.484	0.484	3.870E-87	579	0.927	0.927	Q76JQ2.pdb.gz	FLCN_RAT Folliculin OS=Rattus norvegicus OX=10116 GN=Flcn PE=1 SV=1
2	PDB:6ulgL	0.414	0.495	4.067E-61	458	0.789	0.998	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
3	PDB:6nzdH	0.359	0.500	6.958E-48	387	0.663	0.992	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
4	PDB:8dhbJ	0.363	0.531	6.225E-42	361	0.611	0.981	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
5	AFDB:Q9VS33	0.361	0.451	3.403E-30	460	0.237	0.298	Q9VS33.pdb.gz	Q9VS33_DROME Folliculin OS=Drosophila melanogaster OX=7227 GN=BHD PE=2 SV=1
6	AFDB:O74769	0.332	0.513	7.919E-16	367	0.135	0.213	O74769.pdb.gz	BHD1_SCHPO Folliculin-like protein bhd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bhd1 PE=3 SV=1
7	AFDB:P53237	0.330	0.741	2.302E-13	242	0.092	0.219	P53237.pdb.gz	LST7_YEAST Protein LST7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LST7 PE=1 SV=2
8	AFDB:Q580K5	0.278	0.285	6.947E-13	564	0.159	0.163	Q580K5.pdb.gz	Q580K5_TRYB2 Folliculin/SMCR8 longin domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.630 PE=4 SV=1
9	AFDB:Q8TEV9	0.235	0.154	2.410E-6	937	0.168	0.104	Q8TEV9.pdb.gz	SMCR8_HUMAN Guanine nucleotide exchange protein SMCR8 OS=Homo sapiens OX=9606 GN=SMCR8 PE=1 SV=2
10	AFDB:Q3UMB5	0.232	0.152	3.258E-6	935	0.135	0.083	Q3UMB5.pdb.gz	SMCR8_MOUSE Guanine nucleotide exchange protein SMCR8 OS=Mus musculus OX=10090 GN=Smcr8 PE=1 SV=2
11	PDB:7mgeC	0.219	0.319	7.881E-6	365	0.097	0.153	7mgeC.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
12	PDB:7mgeB	0.236	0.302	1.072E-4	442	0.090	0.118	7mgeB.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
13	PDB:6v4uB	0.228	0.301	2.394E-4	421	0.098	0.135	6v4uB.pdb.gz
14	PDB:7o2wB	0.242	0.320	2.783E-4	422	0.104	0.142	7o2wB.pdb.gz
15	PDB:6lt0C	0.229	0.326	1.319E-3	385	0.086	0.130	6lt0C.pdb.gz
16	PDB:6lt0B	0.227	0.321	2.533E-3	386	0.086	0.130	6lt0B.pdb.gz
17	AFDB:O08873	0.154	0.063	3.160E-3	1602	0.085	0.031	O08873.pdb.gz	MADD_RAT MAP kinase-activating death domain protein OS=Rattus norvegicus OX=10116 GN=Madd PE=1 SV=1
18	AFDB:Q8WXG6	0.158	0.063	4.270E-3	1647	0.086	0.030	Q8WXG6.pdb.gz	MADD_HUMAN MAP kinase-activating death domain protein OS=Homo sapiens OX=9606 GN=MADD PE=1 SV=2
19	PDB:7o2wA	0.228	0.304	4.400E-3	418	0.093	0.129	7o2wA.pdb.gz
20	AFDB:Q8TF40	0.159	0.088	1.165E-2	1166	0.067	0.033	Q8TF40.pdb.gz	FNIP1_HUMAN Folliculin-interacting protein 1 OS=Homo sapiens OX=9606 GN=FNIP1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q76JQ2	0.0	1096	579	0.927	0.927	FLCN_RAT Folliculin OS=Rattus norvegicus OX=10116 GN=Flcn PE=1 SV=1
2	Q8NFG4	0.0	1204	579	1.000	1.000	FLCN_HUMAN Folliculin OS=Homo sapiens OX=9606 GN=FLCN PE=1 SV=1
3	Q8QZS3	0.0	1091	579	0.926	0.926	FLCN_MOUSE Folliculin OS=Mus musculus OX=10090 GN=Flcn PE=1 SV=1
4	Q9VS33	1.43e-40	155	460	0.254	0.320	Q9VS33_DROME Folliculin OS=Drosophila melanogaster OX=7227 GN=BHD PE=2 SV=1
5	O74769	9.02e-18	87.4	367	0.150	0.237	BHD1_SCHPO Folliculin-like protein bhd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bhd1 PE=3 SV=1
6	P53237	0.037	38.5	242	0.105	0.252	LST7_YEAST Protein LST7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LST7 PE=1 SV=2
7	Q80XG9	0.21	37.0	590	0.050	0.049	LRRT4_MOUSE Leucine-rich repeat transmembrane neuronal protein 4 OS=Mus musculus OX=10090 GN=Lrrtm4 PE=1 SV=2
8	B4F7C5	0.26	36.6	590	0.050	0.049	LRRT4_RAT Leucine-rich repeat transmembrane neuronal protein 4 OS=Rattus norvegicus OX=10116 GN=Lrrtm4 PE=1 SV=1
9	Q968Y9	6.7	32.3	1846	0.028	0.009	INSR_CAEEL Insulin-like receptor OS=Caenorhabditis elegans OX=6239 GN=daf-2 PE=1 SV=2
10	Q61321	9.6	31.6	775	0.048	0.036	SIX4_MOUSE Homeobox protein SIX4 OS=Mus musculus OX=10090 GN=Six4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11704 Folliculin	1.4e-46	170.2	Vesicle coat protein involved in Golgi to plasma membrane transport
2	PF16692 Folliculin_C	3.2e-88	306.6	Folliculin C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264433	0.999	Folliculin-interacting protein 2
2	9606.ENSP00000421985	0.999	Folliculin-interacting protein 1
3	9606.ENSP00000362092	0.998	Ras-related GTP-binding protein C
4	9606.ENSP00000369899	0.998	Ras-related GTP-binding protein A
5	9606.ENSP00000278671	0.992	Ragulator complex protein LAMTOR1
6	9606.ENSP00000424183	0.989	Ragulator complex protein LAMTOR3
7	9606.ENSP00000343118	0.988	Ragulator complex protein LAMTOR4
8	9606.ENSP00000256644	0.986	Ragulator complex protein LAMTOR5
9	9606.ENSP00000357288	0.985	Ragulator complex protein LAMTOR2
10	9606.ENSP00000262850	0.984	Ras-related GTP-binding protein B
11	9606.ENSP00000358423	0.981	Ras-related GTP-binding protein D
12	9606.ENSP00000335153	0.947	Heat shock protein HSP 90-alpha
13	9606.ENSP00000273398	0.946	V-type proton ATPase catalytic subunit A
14	9606.ENSP00000374409	0.945	Plakophilin-4
15	9606.ENSP00000285393	0.928	V-type proton ATPase subunit d 2
16	9606.ENSP00000290949	0.917	V-type proton ATPase subunit d 1
17	9606.ENSP00000265686	0.916	V-type proton ATPase 116 kDa subunit a isoform 3
18	9606.ENSP00000379203	0.904	V-type proton ATPase subunit C 1
19	9606.ENSP00000272238	0.902	V-type proton ATPase subunit C 2
20	9606.ENSP00000276390	0.902	V-type proton ATPase subunit B, brain isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.908	molecular function regulator activity
GO:0140677	0.888	molecular function activator activity
GO:0030234	0.789	enzyme regulator activity
GO:0019899	0.785	enzyme binding
GO:0030695	0.739	GTPase regulator activity
GO:0005096	0.566	GTPase activator activity
GO:0140678	0.540	molecular function inhibitor activity
GO:0004857	0.487	enzyme inhibitor activity
GO:0044877	0.451	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.970	cellular process
GO:0050794	0.969	regulation of cellular process
GO:0043467	0.960	regulation of generation of precursor metabolites and energy
GO:0090092	0.960	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1903578	0.960	regulation of ATP metabolic process
GO:0051716	0.957	cellular response to stimulus
GO:1902532	0.955	negative regulation of intracellular signal transduction
GO:0007154	0.954	cell communication
GO:0031325	0.951	positive regulation of cellular metabolic process
GO:0042325	0.948	regulation of phosphorylation
GO:0017015	0.946	regulation of transforming growth factor beta receptor signaling pathway
GO:0032008	0.940	positive regulation of TOR signaling
GO:0023052	0.937	signaling
GO:0031929	0.926	TOR signaling
GO:0010604	0.923	positive regulation of macromolecule metabolic process
GO:0001932	0.923	regulation of protein phosphorylation
GO:0090100	0.916	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051179	0.914	localization
GO:0051128	0.897	regulation of cellular component organization
GO:0051173	0.893	positive regulation of nitrogen compound metabolic process
GO:0010563	0.892	negative regulation of phosphorus metabolic process
GO:0045936	0.880	negative regulation of phosphate metabolic process
GO:0062014	0.871	negative regulation of small molecule metabolic process
GO:0034198	0.854	cellular response to amino acid starvation
GO:0000122	0.850	negative regulation of transcription by RNA polymerase II
GO:0009894	0.815	regulation of catabolic process
GO:0010506	0.783	regulation of autophagy
GO:0033043	0.778	regulation of organelle organization
GO:0042326	0.573	negative regulation of phosphorylation
GO:0050793	0.564	regulation of developmental process
GO:0051726	0.556	regulation of cell cycle
GO:0045935	0.528	positive regulation of nucleobase-containing compound metabolic process
GO:0032879	0.496	regulation of localization
GO:0031328	0.495	positive regulation of cellular biosynthetic process
GO:0010557	0.494	positive regulation of macromolecule biosynthetic process
GO:0045944	0.459	positive regulation of transcription by RNA polymerase II
GO:0030511	0.399	positive regulation of transforming growth factor beta receptor signaling pathway
GO:0032501	0.382	multicellular organismal process
GO:0008152	0.329	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.998	plasma membrane
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005765	0.997	lysosomal membrane
GO:0030496	0.994	midbody
GO:0015630	0.990	microtubule cytoskeleton
GO:0030054	0.988	cell junction
GO:0120025	0.987	plasma membrane bounded cell projection
GO:0070161	0.983	anchoring junction
GO:0005813	0.983	centrosome
GO:0005819	0.977	spindle
GO:0032991	0.962	protein-containing complex
GO:0005929	0.960	cilium
GO:0005911	0.958	cell-cell junction
GO:0072686	0.946	mitotic spindle
GO:0044291	0.944	cell-cell contact zone
GO:0005634	0.940	nucleus
GO:0012505	0.579	endomembrane system
GO:0005654	0.389	nucleoplasm
GO:0031982	0.368	vesicle
GO:0031410	0.319	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]