StarFunc result for job id Q8NFH5

User Input

>input (326 residues)
MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVG
VMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQ
SPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFG
FPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGV
KPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDY
QVISDRQTPKKDESLVSKAMEYMFGW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFH5	1.000	1.000	4.053E-56	326	1.000	1.000	Q8NFH5.pdb.gz	NUP35_HUMAN Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 PE=1 SV=1
2	PDB:7r5jF0	0.273	0.360	4.958E-33	241	0.739	1.000	7r5jF0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
3	AFDB:Q9UPQ9	0.227	0.046	1.018E-6	1833	0.172	0.031	Q9UPQ9.pdb.gz	TNR6B_HUMAN Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4
4	AFDB:Q9SAB3	0.246	0.201	1.087E-6	405	0.080	0.064	Q9SAB3.pdb.gz	RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana OX=3702 GN=RBP45B PE=1 SV=1
5	AFDB:P91156	0.222	0.136	1.722E-6	580	0.117	0.066	P91156.pdb.gz	P91156_CAEEL SAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acin-1 PE=1 SV=2
6	AFDB:Q8SY33	0.238	0.064	3.548E-6	1384	0.153	0.036	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
7	AFDB:Q9VHC0	0.205	0.180	4.614E-6	374	0.156	0.136	Q9VHC0.pdb.gz	Q9VHC0_DROME LD23870p OS=Drosophila melanogaster OX=7227 GN=RnpS1 PE=1 SV=2
8	AFDB:Q8IGV1	0.209	0.080	7.310E-6	977	0.144	0.048	Q8IGV1.pdb.gz	Q8IGV1_DROME RE24907p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Saf-B PE=2 SV=1
9	AFDB:Q10145	0.214	0.101	1.084E-5	738	0.156	0.069	Q10145.pdb.gz	YAS9_SCHPO Uncharacterized RNA-binding protein C3H8.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H8.09c PE=4 SV=1
10	AFDB:Q8VXZ9	0.221	0.174	1.320E-5	425	0.067	0.052	Q8VXZ9.pdb.gz	R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana OX=3702 GN=RBP47B' PE=2 SV=1
11	PDB:7oqcF	0.228	0.274	1.834E-5	267	0.086	0.105	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
12	AFDB:O94260	0.209	0.160	2.386E-5	434	0.132	0.099	O94260.pdb.gz	G3BP_SCHPO Putative G3BP-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nxt3 PE=1 SV=1
13	PDB:7dvqI	0.197	0.480	8.313E-5	128	0.049	0.125	7dvqI.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:6ff7X	0.222	0.402	8.878E-5	171	0.043	0.082	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
15	PDB:6y53o	0.200	0.388	1.081E-4	160	0.052	0.106	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:5vsuA	0.209	0.178	1.155E-4	387	0.046	0.039	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
17	PDB:3lqvB	0.203	0.536	1.502E-4	115	0.052	0.148	3lqvB.pdb.gz	Branch Recognition by SF3b14
18	PDB:7dvqY	0.195	0.419	2.379E-4	140	0.052	0.121	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:3pgwP	0.229	0.570	2.897E-4	113	0.037	0.106	3pgwP.pdb.gz
20	PDB:6y5qq	0.182	0.317	3.094E-4	178	0.037	0.067	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68FY1	0.0	622	325	0.945	0.948	NUP35_RAT Nucleoporin NUP35 OS=Rattus norvegicus OX=10116 GN=Nup35 PE=1 SV=1
2	Q8NFH5	0.0	657	326	1.000	1.000	NUP35_HUMAN Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 PE=1 SV=1
3	Q8R4R6	0.0	612	325	0.929	0.932	NUP35_MOUSE Nucleoporin NUP35 OS=Mus musculus OX=10090 GN=Nup35 PE=1 SV=2
4	Q09601	2.13e-13	72.4	381	0.089	0.076	NUP35_CAEEL Nucleoporin NUP35 OS=Caenorhabditis elegans OX=6239 GN=npp-19 PE=1 SV=2
5	Q75JH1	4.45e-12	68.9	522	0.153	0.096	Q75JH1_DICDI RRM Nup35-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276109 PE=4 SV=1
6	O13838	2.16e-04	45.1	371	0.156	0.137	NUP40_SCHPO Nucleoporin nup40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup40 PE=1 SV=1
7	Q03790	5.30e-04	43.9	475	0.132	0.091	NUP53_YEAST Nucleoporin NUP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP53 PE=1 SV=1
8	A8K8P3	0.65	34.3	1242	0.083	0.022	SFI1_HUMAN Protein SFI1 homolog OS=Homo sapiens OX=9606 GN=SFI1 PE=1 SV=2
9	Q9VJE5	1.1	33.9	1690	0.052	0.010	CL190_DROME Restin homolog OS=Drosophila melanogaster OX=7227 GN=CLIP-190 PE=1 SV=1
10	Q9VIV2	1.3	33.5	1062	0.049	0.015	SWM_DROME Zinc finger protein swm OS=Drosophila melanogaster OX=7227 GN=swm PE=1 SV=1
11	M9PC48	6.7	31.2	18095	0.120	0.002	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PCJ6	6.7	31.2	18641	0.120	0.002	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	P38760	7.3	30.8	659	0.055	0.027	MIP6_YEAST RNA-binding protein MIP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIP6 PE=1 SV=1
14	F7BMG3	7.7	30.8	437	0.061	0.046	F7BMG3_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 PE=1 SV=2
15	P57080	7.7	30.8	1055	0.071	0.022	UBP25_MOUSE Ubiquitin carboxyl-terminal hydrolase 25 OS=Mus musculus OX=10090 GN=Usp25 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05172 Nup35_RRM	5.7e-23	92.1	Nup53/35/40-type RNA recognition motif
2	PF14605 Nup35_RRM_2	1.6e-06	39.3	Nup53/35/40-type RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007827

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000024388	0.997	Nuclear pore complex protein Nup93
2	61853.ENSNLEP00000019728	0.992	Nucleoporin 155kDa
3	61853.ENSNLEP00000021010	0.974	Uncharacterized protein
4	61853.ENSNLEP00000004509	0.963	Functions as a component of the nuclear pore complex (NPC).
5	61853.ENSNLEP00000017960	0.960	Nucleoporin 160kDa
6	61853.ENSNLEP00000005864	0.942	Nucleoporin 210kDa
7	61853.ENSNLEP00000009867	0.938	Nucleoporin 54kDa
8	61853.ENSNLEP00000005468	0.936	SEC13 homolog, nuclear pore and COPII coat complex component
9	61853.ENSNLEP00000016844	0.932	Nucleoporin 62kDa C-terminal like
10	61853.ENSNLEP00000013339	0.926	Nucleoporin 210kDa-like
11	61853.ENSNLEP00000004255	0.892	NDC1 transmembrane nucleoporin
12	61853.ENSNLEP00000001412	0.887	Nucleoporin 153kDa
13	61853.ENSNLEP00000008375	0.886	Nuclear receptor coactivator 5
14	61853.ENSNLEP00000021403	0.884	Uncharacterized protein
15	61853.ENSNLEP00000011097	0.873	SEH1-like (S. cerevisiae)
16	61853.ENSNLEP00000007746	0.864	Nucleoporin 37kDa
17	61853.ENSNLEP00000016432	0.860	Nucleoporin 205kDa
18	61853.ENSNLEP00000005932	0.845	Nuclear transport factor 2
19	61853.ENSNLEP00000000852	0.844	Functions as a component of the nuclear pore complex (NPC).
20	61853.ENSNLEP00000009128	0.840	RAN binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.353	identical protein binding
GO:1901363	0.318	heterocyclic compound binding
GO:0097159	0.318	organic cyclic compound binding
GO:0003676	0.312	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071345	0.986	cellular response to cytokine stimulus
GO:1990823	0.965	response to leukemia inhibitory factor
GO:1990830	0.928	cellular response to leukemia inhibitory factor
GO:0065007	0.506	biological regulation
GO:0050794	0.488	regulation of cellular process
GO:0071840	0.362	cellular component organization or biogenesis
GO:0016043	0.305	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0012505	0.997	endomembrane system
GO:0005829	0.997	cytosol
GO:0016020	0.994	membrane
GO:0031090	0.969	organelle membrane
GO:0032991	0.965	protein-containing complex
GO:0005886	0.960	plasma membrane
GO:0005635	0.913	nuclear envelope
GO:0031965	0.648	nuclear membrane
GO:0034399	0.338	nuclear periphery
GO:0043232	0.307	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]