StarFunc result for job id Q8NFH8

User Input

>input (660 residues)
MEAAAAAAAAAAAAAAAGGGCGSGPPPLLLSEGEQQCYSELFARCAGAAGGGPGSGPPEA
ARVAPGTATAAAGPVADLFRASQLPAETLHQITELCGAKRVGYFGPTQFYIALKLIAAAQ
SGLPVRIESIKCELPLPRFMMSKNDGEIRFGNPAELHGTKVQIPYLTTEKNSFKRMDDED
KQQETQSPTMSPLASPPSSPPHYQRVPLSHGYSKLRSSAEQMHPAPYEARQPLVQPEGSS
SGGPGTKPLRHQASLIRSFSVERELQDNSSYPDEPWRITEEQREYYVNQFRSLQPDPSSF
ISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGL
PPTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMADLPVPNQDV
TSDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTP
PPRPQKTHSRASSLDLNKVFQPSVPATKSGLLPPPPALPPRPCPSQSEQVSEAELLPQLS
RAPSQAAESSPAKKDVLYSQPPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPT
VQKQSSKQKKAIQTAIRKNKEANAVLARLNSELQQQLKEVHQERIALENQLEQLRPVTVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFH8	0.999	0.999	6.019E-86	660	1.000	1.000	Q8NFH8.pdb.gz	REPS2_HUMAN RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens OX=9606 GN=REPS2 PE=1 SV=2
2	AFDB:Q96D71	0.191	0.167	3.039E-31	796	0.405	0.335	Q96D71.pdb.gz	REPS1_HUMAN RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1 PE=1 SV=3
3	AFDB:Q8MQS4	0.156	0.117	3.426E-19	907	0.236	0.172	Q8MQS4.pdb.gz	Q8MQS4_DROME GH06923p OS=Drosophila melanogaster OX=7227 GN=Reps PE=1 SV=1
4	PDB:4cidA	0.133	0.176	9.320E-5	497	0.058	0.076	4cidA.pdb.gz	Structural Insights Into Membrane Interaction and Caveolar Targeting of Dynamin-Like Ehd2.
5	PDB:7soxA	0.131	0.167	1.058E-3	514	0.059	0.076	7soxA.pdb.gz
6	AFDB:Q9UMZ2	0.132	0.068	1.523E-2	1314	0.136	0.068	Q9UMZ2.pdb.gz	SYNRG_HUMAN Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG PE=1 SV=2
7	AFDB:Q0KI93	0.072	0.075	2.222E-2	630	0.147	0.154	Q0KI93.pdb.gz	Q0KI93_DROME WHAMM and JMY related, isoform B OS=Drosophila melanogaster OX=7227 GN=Whamy PE=4 SV=1
8	AFDB:Q9JKC9	0.125	0.067	3.423E-2	1329	0.144	0.071	Q9JKC9.pdb.gz	SYNRG_RAT Synergin gamma OS=Rattus norvegicus OX=10116 GN=Synrg PE=1 SV=3
9	AFDB:Q24248	0.065	0.061	4.483E-2	717	0.135	0.124	Q24248.pdb.gz	ARA_DROME Homeobox protein araucan OS=Drosophila melanogaster OX=7227 GN=ara PE=1 SV=2
10	AFDB:Q585K3	0.068	0.075	4.732E-2	601	0.138	0.151	Q585K3.pdb.gz	Q585K3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.220 PE=4 SV=1
11	AFDB:O60548	0.070	0.088	5.564E-2	495	0.112	0.149	O60548.pdb.gz	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2
12	AFDB:Q38FG4	0.062	0.037	5.873E-2	1366	0.124	0.060	Q38FG4.pdb.gz	Q38FG4_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2290 PE=4 SV=1
13	PDB:7eebI	0.102	0.346	4.239E-1	174	0.026	0.098	7eebI.pdb.gz	Structure of a mammalian sperm cation channel complex.
14	PDB:2f2pA	0.092	0.293	4.722E-1	169	0.029	0.112	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
15	PDB:6ya9A	0.094	0.146	4.722E-1	400	0.033	0.055	6ya9A.pdb.gz	Genetically encoded photo-switchable molecular sensors for optoacoustic and super-resolution imaging.
16	PDB:1ggzA	0.088	0.345	6.529E-1	144	0.026	0.118	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
17	PDB:5aanA	0.089	0.284	6.529E-1	183	0.020	0.071	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
18	PDB:6gezB	0.091	0.112	6.529E-1	532	0.020	0.024	6gezB.pdb.gz	Dynamic tuning of FRET in a green fluorescent protein biosensor.
19	PDB:5x9aB	0.093	0.290	6.891E-1	198	0.014	0.045	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition
20	PDB:1v1fA	0.090	0.285	8.103E-1	188	0.017	0.059	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NFH8	0.0	1336	660	1.000	1.000	REPS2_HUMAN RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens OX=9606 GN=REPS2 PE=1 SV=2
2	Q96D71	1.06e-76	263	796	0.250	0.207	REPS1_HUMAN RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1 PE=1 SV=3
3	O54916	3.08e-75	259	795	0.252	0.209	REPS1_MOUSE RalBP1-associated Eps domain-containing protein 1 OS=Mus musculus OX=10090 GN=Reps1 PE=1 SV=2
4	M9NDL7	1.76e-27	120	878	0.080	0.060	M9NDL7_DROME RALBP1 associated Eps domain containing, isoform B OS=Drosophila melanogaster OX=7227 GN=Reps PE=1 SV=1
5	Q8MQS4	2.05e-27	120	907	0.080	0.058	Q8MQS4_DROME GH06923p OS=Drosophila melanogaster OX=7227 GN=Reps PE=1 SV=1
6	Q6GMY7	8.40e-15	80.1	648	0.061	0.062	Q6GMY7_HUMAN ITSN1 protein (Fragment) OS=Homo sapiens OX=9606 GN=ITSN1 PE=2 SV=1
7	F8W7U0	2.52e-14	79.3	1149	0.061	0.035	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1
8	Q15811	6.74e-14	78.2	1721	0.061	0.023	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
9	Q9WVE9	1.39e-13	77.0	1713	0.061	0.023	ITSN1_RAT Intersectin-1 OS=Rattus norvegicus OX=10116 GN=Itsn1 PE=1 SV=2
10	Q9Z0R4	3.67e-13	75.5	1714	0.059	0.023	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
11	O61618	9.11e-13	74.3	1094	0.056	0.034	O61618_DROME Dynamin associated protein isoform Dap160-1 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
12	Q1WWC9	9.11e-13	74.3	1096	0.056	0.034	Q1WWC9_DROME Dynamin associated protein 160, isoform C OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
13	Q9VIF7	9.19e-13	74.3	1097	0.056	0.034	Q9VIF7_DROME Dynamin associated protein 160, isoform A OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
14	M9PBF6	9.49e-13	74.3	1088	0.056	0.034	M9PBF6_DROME Dynamin associated protein 160, isoform G OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
15	O61639	1.10e-12	73.9	1011	0.056	0.037	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
16	Q8INU2	1.13e-12	73.9	1014	0.056	0.036	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
17	M9PDC7	1.18e-12	73.9	1005	0.056	0.037	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
18	M9ND00	1.28e-12	73.9	1190	0.056	0.031	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
19	Q10172	1.80e-11	70.1	1794	0.052	0.019	PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan1 PE=1 SV=1
20	Q9NZM3	2.79e-11	69.7	1697	0.056	0.022	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20531 DUF6746	97	14.3	Family of unknown function (DUF6746)
2	PF00036 EF-hand_1	94	14.0	EF hand
3	PF12763 EF-hand_4	1.9e-09	48.8	Cytoskeletal-regulatory complex EF hand
4	PF13499 EF-hand_7	32	16.4	EF-hand domain pair
5	PF13833 EF-hand_8	4.2e+02	12.1	EF-hand domain pair
6	PF16183 Kinesin_assoc	4.1e+02	12.6	Kinesin-associated
7	PF15035 Rootletin	32	16.1	Ciliary rootlet component, centrosome cohesion

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000406209	0.990	Epsin-1
2	9606.ENSP00000019317	0.984	RalA-binding protein 1
3	9606.ENSP00000351926	0.930	AP-2 complex subunit alpha-1
4	9606.ENSP00000376345	0.892	Growth factor receptor-bound protein 2
5	9606.ENSP00000392065	0.879	RalBP1-associated Eps domain-containing protein 1
6	9606.ENSP00000292807	0.855	AP-2 complex subunit mu
7	9606.ENSP00000360798	0.828	Epidermal growth factor receptor substrate 15
8	9606.ENSP00000369500	0.798	Plays a role in adipocyte differentiation by promoting mTORC2-mediated phosphorylation of AKT1 at 'Ser-473' after growth factor stimulation
9	9606.ENSP00000336666	0.767	AP-1 complex subunit sigma-1A
10	9606.ENSP00000263270	0.745	AP-2 complex subunit sigma
11	9606.ENSP00000265171	0.743	Pro-epidermal growth factor
12	9606.ENSP00000482835	0.738	AP-2 complex subunit beta
13	9606.ENSP00000444957	0.737	AP-1 complex subunit sigma-2
14	9606.ENSP00000327694	0.727	AP-2 complex subunit alpha-2
15	9606.ENSP00000369643	0.722	Gastrin-releasing peptide receptor
16	9606.ENSP00000320543	0.714	Epsin-2
17	9606.ENSP00000369699	0.705	Collectrin
18	9606.ENSP00000360076	0.700	SH3-containing GRB2-like protein 3-interacting protein 1
19	9606.ENSP00000479606	0.682	Clathrin heavy chain 1
20	9606.ENSP00000401264	0.679	CTP synthase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	0.999	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0038127	0.987	ERBB signaling pathway
GO:0016043	0.979	cellular component organization
GO:0043933	0.937	protein-containing complex organization
GO:0044085	0.921	cellular component biogenesis
GO:0007173	0.921	epidermal growth factor receptor signaling pathway
GO:0022607	0.902	cellular component assembly
GO:0065003	0.575	protein-containing complex assembly
GO:0051179	0.461	localization
GO:0051234	0.435	establishment of localization
GO:0006810	0.395	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.960	membrane
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0012505	0.932	endomembrane system
GO:0005886	0.924	plasma membrane
GO:0031982	0.817	vesicle
GO:0031410	0.521	cytoplasmic vesicle
GO:0005634	0.489	nucleus
GO:0070013	0.422	intracellular organelle lumen
GO:0005794	0.306	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]