StarFunc result for job id Q8NFL0

User Input

>input (401 residues)
MSLWKKTVYRSLCLALALLVAVTVFQRSLTPGQFLQEPPPPTLEPQKAQKPNGQLVNPNN
FWKNPKDVAAPTPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYF
PMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGRERQSAGGGRGAVRTLFLLGTA
SKQEERTHYQQLLAYEDRLYGDILQWGFLDTFFNLTLKEIHFLKWLDIYCPHVPFIFKGD
DDVFVNPTNLLEFLADRQPQENLFVGDVLQHARPIRRKDNKYYIPGALYGKASYPPYAGG
GGFLMAGSLARRLHHACDTLELYPIDDVFLGMCLEVLGVQPTAHEGFKTFGISRNRNSRM
NKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFL0	1.000	1.000	2.163E-85	401	1.000	1.000	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
2	AFDB:Q8K0J2	0.861	0.869	5.167E-73	397	0.853	0.861	Q8K0J2.pdb.gz	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
3	AFDB:Q9Y2A9	0.742	0.798	7.846E-42	372	0.389	0.419	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
4	AFDB:Q6ZMB0	0.743	0.774	6.494E-41	384	0.369	0.385	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
5	AFDB:Q9C0J1	0.716	0.758	1.092E-37	378	0.384	0.407	Q9C0J1.pdb.gz	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
6	AFDB:Q9Z222	0.720	0.727	1.222E-36	397	0.364	0.368	Q9Z222.pdb.gz	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
7	PDB:7jhiC	0.698	0.840	1.215E-35	331	0.317	0.384	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
8	AFDB:Q9NY97	0.697	0.703	6.192E-35	397	0.349	0.353	Q9NY97.pdb.gz	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
9	AFDB:O43825	0.630	0.602	8.549E-30	422	0.269	0.256	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
10	AFDB:Q7Z7M8	0.681	0.687	1.305E-29	397	0.312	0.315	Q7Z7M8.pdb.gz	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
11	AFDB:O54904	0.621	0.759	1.218E-28	326	0.229	0.282	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
12	PDB:4y63A	0.282	0.376	2.515E-5	282	0.107	0.152	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
13	PDB:6fxrA	0.287	0.183	3.014E-5	700	0.070	0.040	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
14	PDB:4fixA	0.296	0.203	1.138E-4	629	0.087	0.056	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
15	PDB:7d72A	0.269	0.265	2.650E-4	407	0.075	0.074	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
16	PDB:4hg6A	0.339	0.194	2.990E-4	747	0.097	0.052	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
17	PDB:1ll0B	0.330	0.456	4.847E-4	267	0.097	0.146	1ll0B.pdb.gz
18	PDB:8cvzI	0.337	0.466	8.866E-4	267	0.097	0.146	8cvzI.pdb.gz
19	PDB:2xwnB	0.297	0.472	1.063E-3	227	0.077	0.137	2xwnB.pdb.gz	Structural and Functional Studies on Mycobacterial Ispd Enzymes
20	PDB:7x8kB	0.247	0.265	1.944E-3	367	0.092	0.101	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K0J2	0.0	721	397	0.853	0.861	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
2	Q8NFL0	0.0	835	401	1.000	1.000	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
3	Q9Y2A9	2.07e-91	281	372	0.349	0.376	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
4	Q9C0J1	1.22e-88	275	378	0.389	0.413	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
5	Q6ZMB0	8.57e-87	270	384	0.359	0.375	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
6	Q9Z222	1.84e-81	257	397	0.342	0.345	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
7	Q9NY97	7.05e-81	255	397	0.322	0.325	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
8	Q9BYG0	5.36e-53	182	378	0.249	0.265	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
9	Q99NB2	6.69e-48	169	377	0.224	0.239	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
10	Q8BGY6	1.12e-47	168	376	0.227	0.242	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
11	O43825	4.99e-45	162	422	0.279	0.265	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
12	O54905	1.77e-44	161	422	0.222	0.211	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
13	O54904	1.23e-43	156	326	0.207	0.255	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
14	Q9Y5Z6	1.23e-43	156	326	0.207	0.255	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
15	Q7Z7M8	1.90e-43	157	397	0.274	0.277	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
16	Q9Y2C3	4.20e-41	149	310	0.209	0.271	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
17	Q9JI67	4.66e-40	146	308	0.207	0.269	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
18	Q920V1	5.34e-38	141	331	0.239	0.290	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
19	O75752	4.23e-36	136	331	0.227	0.275	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
20	Q9VLS8	5.24e-31	126	585	0.185	0.126	Q9VLS8_DROME LD29807p OS=Drosophila melanogaster OX=7227 GN=GalT4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04646 DUF604	4.7	18.1	Protein of unknown function, DUF604
2	PF02434 Fringe	0.00034	31.7	Fringe-like
3	PF01762 Galactosyl_T	8.9e-45	164.4	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287590

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266719	0.959	Keratocan
2	9606.ENSP00000266718	0.936	Lumican
3	9606.ENSP00000364700	0.916	Osteomodulin
4	9606.ENSP00000368771	0.916	Mucin-3A
5	9606.ENSP00000414350	0.913	Mucin-20
6	9606.ENSP00000441929	0.911	Mucin-12
7	9606.ENSP00000347041	0.910	Fibromodulin
8	9606.ENSP00000262551	0.907	Mimecan
9	9606.ENSP00000484824	0.906	Mucin-1
10	9606.ENSP00000406861	0.905	Mucin-6
11	9606.ENSP00000436812	0.904	Mucin-5B
12	9606.ENSP00000302716	0.903	Mucin-17
13	9606.ENSP00000417498	0.903	Mucin-4
14	9606.ENSP00000343924	0.902	Prolargin
15	9606.ENSP00000485659	0.902	Mucin-5AC
16	9606.ENSP00000311364	0.900	Mucin-like protein 1
17	9606.ENSP00000365473	0.900	Mucin-21
18	9606.ENSP00000381008	0.900	Mucin-16
19	9606.ENSP00000387356	0.900	Aggrecan core protein
20	9606.ENSP00000407422	0.900	Mucin-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048531	1.000	beta-1,3-galactosyltransferase activity
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0005515	0.999	protein binding
GO:0008499	0.993	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0008532	0.436	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901566	0.996	organonitrogen compound biosynthetic process
GO:0044272	0.995	sulfur compound biosynthetic process
GO:0006022	0.995	aminoglycan metabolic process
GO:0006024	0.988	glycosaminoglycan biosynthetic process
GO:1903510	0.987	mucopolysaccharide metabolic process
GO:0044238	0.984	primary metabolic process
GO:0019538	0.974	protein metabolic process
GO:0009101	0.955	glycoprotein biosynthetic process
GO:0006486	0.915	protein glycosylation
GO:0006493	0.781	protein O-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0071944	0.919	cell periphery
GO:0070013	0.510	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:14389	0.436	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP
EC:2.4.1.149	0.436	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase.

[back to server]