StarFunc result for job id Q8NFP9

User Input

>input (1400 residues)
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGM
INPSVPIRNIRMKFAVLIGLIQVGEVSNRDIVETVLNLLVGGEFDLEMNFIIQDAESITC
MTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVD
MLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSA
AAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFRTSKGVGYSAHFVGNCL
IVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHV
NTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKS
ESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCLESSPKENASIFVHSPHALMLQD
VKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVA
MQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILF
NPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWVINPADSS
GITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIH
DVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKR
KVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQ
NPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLG
YINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAK
MYEEYQRQEEENIKKGKKGNVSTISGLSSQTTGAKGGMEIREIEDLSQSQSPESETDYPV
STDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPET
LVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKEDLP
NSSTSFLFDKIPKQEEKLLPELSSNHIIPNIQDTQVHLGVSDDLGLLAHMTGSVDLTCTS
SIIEEKEFKIHTTSDGMSSISERDLASSTKGLEYAEMTATTLETESSSSKIVPNIDAGSI
ISDTERSDDGKESGKEIRKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQF
SPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVHVWRSHSTKSVMDFVNSNENIIFVH
NTIHLISQMVDNIIIACGGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9QCE1	0.398	0.914	8.086E-80	607	0.395	0.911	E9QCE1.pdb.gz
2	AFDB:Q19317	0.634	0.359	1.956E-77	2507	0.286	0.160	Q19317.pdb.gz	NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans OX=6239 GN=sel-2 PE=2 SV=3
3	AFDB:Q6PR54	0.192	0.127	1.018E-7	2419	0.113	0.065	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
4	PDB:7zl1A	0.107	0.624	9.575E-7	215	0.016	0.107	7zl1A.pdb.gz
5	AFDB:Q54I18	0.155	0.191	1.973E-6	1046	0.084	0.113	Q54I18.pdb.gz	SMEK_DICDI Suppressor of Mek1 OS=Dictyostelium discoideum OX=44689 GN=smkA PE=1 SV=1
6	AFDB:Q5UIP0	0.165	0.116	2.829E-6	2472	0.109	0.061	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
7	AFDB:F4J8G7	0.133	0.098	5.819E-6	2138	0.095	0.062	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
8	PDB:2a3wA	0.104	0.631	8.671E-6	204	0.022	0.152	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
9	PDB:1b09A	0.108	0.651	1.148E-5	206	0.019	0.131	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
10	PDB:7qfqA	0.095	0.102	1.294E-5	1291	0.044	0.048	7qfqA.pdb.gz
11	PDB:7ufgA	0.100	0.120	2.179E-5	1151	0.020	0.024	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
12	PDB:7ufgB	0.098	0.116	2.361E-5	1182	0.021	0.025	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:4pbpB	0.109	0.653	2.558E-5	210	0.017	0.114	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
14	PDB:3ffzA	0.094	0.105	3.386E-5	1246	0.031	0.035	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
15	PDB:5n0cA	0.104	0.112	3.818E-5	1293	0.042	0.046	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
16	PDB:3v0aB	0.098	0.117	4.136E-5	1150	0.031	0.038	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
17	AFDB:Q8WYP5	0.090	0.067	1.753E-4	2266	0.104	0.064	Q8WYP5.pdb.gz	ELYS_HUMAN Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3
18	AFDB:X1WE68	0.107	0.073	2.320E-4	2527	0.116	0.064	X1WE68.pdb.gz
19	AFDB:Q550K8	0.080	0.058	3.328E-4	2454	0.097	0.055	Q550K8.pdb.gz	Y7071_DICDI Probable serine/threonine-protein kinase DDB_G0277071 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277071 PE=3 SV=1
20	AFDB:Q9VPS7	0.062	0.064	3.013E-3	1305	0.084	0.090	Q9VPS7.pdb.gz	Q9VPS7_DROME Metabotropic GABA-B receptor subtype 3, isoform A OS=Drosophila melanogaster OX=7227 GN=GABA-B-R3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EZD1	0.0	2301	2998	0.831	0.388	E7EZD1_DANRE Neurobeachin OS=Danio rerio OX=7955 GN=im:7138260 PE=1 SV=2
2	P50851	0.0	1636	2863	0.597	0.292	LRBA_HUMAN Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4
3	Q19317	0.0	786	2507	0.281	0.157	NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans OX=6239 GN=sel-2 PE=2 SV=3
4	Q9EPN1	0.0	2820	2936	0.970	0.463	NBEA_MOUSE Neurobeachin OS=Mus musculus OX=10090 GN=Nbea PE=1 SV=1
5	Q9ESE1	0.0	1654	2856	0.611	0.300	LRBA_MOUSE Lipopolysaccharide-responsive and beige-like anchor protein OS=Mus musculus OX=10090 GN=Lrba PE=1 SV=1
6	Q9W4E2	0.0	699	3466	0.242	0.098	NBEA_DROME Neurobeachin OS=Drosophila melanogaster OX=7227 GN=rg PE=1 SV=4
7	F4I9T0	1.91e-53	209	2604	0.160	0.086	BCHB_ARATH BEACH domain-containing protein B OS=Arabidopsis thaliana OX=3702 GN=BCHB PE=4 SV=1
8	Q54RQ8	1.25e-33	144	2192	0.094	0.060	LVSE_DICDI BEACH domain-containing protein lvsE OS=Dictyostelium discoideum OX=44689 GN=lvsE PE=4 SV=1
9	F4JD14	2.36e-14	81.3	1941	0.091	0.066	BCHC1_ARATH BEACH domain-containing protein C1 OS=Arabidopsis thaliana OX=3702 GN=BCHC1 PE=1 SV=1
10	E7FAW3	5.28e-11	70.5	2801	0.056	0.028	NBEL2_DANRE Neurobeachin-like protein 2 OS=Danio rerio OX=7955 GN=nbeal2 PE=1 SV=1
11	Q6ZNJ1	8.99e-10	66.2	2754	0.031	0.016	NBEL2_HUMAN Neurobeachin-like protein 2 OS=Homo sapiens OX=9606 GN=NBEAL2 PE=1 SV=2
12	Q6ZQA0	7.86e-08	59.7	2742	0.032	0.016	NBEL2_MOUSE Neurobeachin-like protein 2 OS=Mus musculus OX=10090 GN=Nbeal2 PE=1 SV=2
13	Q55DM1	2.59e-07	58.2	3619	0.053	0.020	LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum OX=44689 GN=lvsA PE=4 SV=2
14	Q55AV3	1.20e-05	52.8	2967	0.061	0.029	LVSD_DICDI BEACH domain-containing protein lvsD OS=Dictyostelium discoideum OX=44689 GN=lvsD PE=4 SV=2
15	Q6VNB8	4.34e-04	47.8	3508	0.052	0.021	WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus OX=10090 GN=Wdfy3 PE=1 SV=1
16	Q8IZQ1	0.012	42.7	3526	0.047	0.019	WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens OX=9606 GN=WDFY3 PE=1 SV=2
17	Q86JF2	0.14	39.3	4118	0.036	0.012	LVSB_DICDI BEACH domain-containing protein lvsB OS=Dictyostelium discoideum OX=44689 GN=lvsB PE=4 SV=1
18	E9Q2M9	0.53	37.4	3183	0.051	0.022	WDFY4_MOUSE WD repeat- and FYVE domain-containing protein 4 OS=Mus musculus OX=10090 GN=Wdfy4 PE=1 SV=2
19	Q9JLB4	0.97	36.6	3623	0.018	0.007	CUBN_MOUSE Cubilin OS=Mus musculus OX=10090 GN=Cubn PE=1 SV=3
20	O76216	0.98	36.2	813	0.014	0.023	O76216_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=Gcn5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15787 DUF4704	1.1e-181	616.6	Neurobeachin/BDCP, DUF4704 alpha solenoid region
2	PF13385 Laminin_G_3	3.4e-09	48.4	Concanavalin A-like lectin/glucanases superfamily
3	PF20425 Neurobeachin	9.2e-08	43.1	Neurobeachin alpha solenoid region
4	PF08288 PIGA	1.7e+02	14.2	PIGA (GPI anchor biosynthesis)
5	PF00790 VHS	4.6e+02	12.1	VHS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010377838.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010382447.1	0.820	Belongs to the MAGUK family.
2	61622.XP_010368509.1	0.671	cAMP-dependent protein kinase type II-alpha regulatory subunit
3	61622.XP_010371167.1	0.605	Notch 1
4	61622.XP_010380717.1	0.601	Protein kinase cAMP-dependent type II regulatory subunit beta
5	61622.XP_010381420.1	0.552	Mab-21 like 1
6	61622.XP_010354030.1	0.546	RCAN family member 3
7	61622.XP_010356344.1	0.541	Belongs to the ligand-gated ion channel (TC 1.A.9) family.
8	61622.XP_010355576.1	0.538	Pleckstrin homology domain containing A1
9	61622.XP_010357820.1	0.538	LIM and senescent cell antigen-like-containing domain protein 2
10	61622.XP_010361743.1	0.538	LIM zinc finger domain containing 2
11	61622.XP_010367001.1	0.538	Adapter protein in a cytoplasmic complex linking beta- integrins to the actin cytoskeleton, bridges the complex to cell surface receptor tyrosine kinases and growth factor receptors.
12	61622.XP_010375112.1	0.516	WD repeat and FYVE domain-containing protein 3 isoform X1
13	61622.XP_010381164.1	0.516	WDFY family member 4
14	61622.XP_010381412.1	0.500	Serine/threonine-protein kinase DCLK1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.779	enzyme binding
GO:0019900	0.512	kinase binding
GO:0019901	0.449	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.958	cellular component organization
GO:0034330	0.918	cell junction organization
GO:0050789	0.916	regulation of biological process
GO:0050794	0.912	regulation of cellular process
GO:0032501	0.878	multicellular organismal process
GO:0048856	0.809	anatomical structure development
GO:0051179	0.802	localization
GO:0007275	0.742	multicellular organism development
GO:0048731	0.681	system development
GO:0044085	0.679	cellular component biogenesis
GO:0050808	0.666	synapse organization
GO:0007399	0.646	nervous system development
GO:0051641	0.575	cellular localization
GO:0022607	0.489	cellular component assembly
GO:0034329	0.476	cell junction assembly
GO:0016358	0.450	dendrite development
GO:0050896	0.321	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0005886	0.997	plasma membrane
GO:0005737	0.981	cytoplasm
GO:0043231	0.925	intracellular membrane-bounded organelle
GO:0012505	0.888	endomembrane system
GO:0005829	0.812	cytosol
GO:0031981	0.697	nuclear lumen
GO:0005794	0.506	Golgi apparatus
GO:0030054	0.478	cell junction
GO:0048471	0.362	perinuclear region of cytoplasm
GO:0031984	0.353	organelle subcompartment
GO:0098791	0.337	Golgi apparatus subcompartment
GO:0098590	0.335	plasma membrane region
GO:0098794	0.331	postsynapse
GO:0005802	0.305	trans-Golgi network

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]