StarFunc result for job id Q8NFT6

User Input

>input (615 residues)
MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAG
KNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETS
AMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQGSISGGGSGGSSSLLTNARSWGVR
ILHVDEMMMHVQQLSLASLCVKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKF
RPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKGY
CECCQEAFEELHVHLQSAQHRSFALEAHLYAEVDRIIAQLSHSFADIPFQAGLPRWSGSP
ASDCDPLCPETLHPHQPSHPRAASPRIRKEDSCQASVTQGRAAGQQRWTESLDGVMGPPA
SHTCVSATTLLPALPKGSREQGCLCPCPASFTQSHLVTSLALLPGEWSPAEDMPLHPSQE
NSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLR
LGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNT
PQPFLHCGFLAVDSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFT6	1.000	1.000	0.000	615	1.000	1.000	Q8NFT6.pdb.gz	DBF4B_HUMAN Protein DBF4 homolog B OS=Homo sapiens OX=9606 GN=DBF4B PE=1 SV=1
2	AFDB:Q9QZ41	0.228	0.214	2.508E-31	663	0.260	0.241	Q9QZ41.pdb.gz	DBF4A_MOUSE Protein DBF4 homolog A OS=Mus musculus OX=10090 GN=Dbf4 PE=1 SV=1
3	AFDB:Q9UBU7	0.173	0.159	1.019E-29	674	0.246	0.224	Q9UBU7.pdb.gz	DBF4A_HUMAN Protein DBF4 homolog A OS=Homo sapiens OX=9606 GN=DBF4 PE=1 SV=1
4	PDB:7pt6I	0.137	0.227	6.697E-8	341	0.081	0.147	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
5	PDB:7p5zG	0.118	0.323	1.664E-7	213	0.068	0.197	7p5zG.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.
6	PDB:7v3vI	0.116	0.212	6.105E-7	328	0.080	0.149	7v3vI.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
7	AFDB:Q09103	0.070	0.033	4.367E-4	1457	0.137	0.058	Q09103.pdb.gz	DGK2_DROME Eye-specific diacylglycerol kinase OS=Drosophila melanogaster OX=7227 GN=rdgA PE=2 SV=2
8	AFDB:Q94LW1	0.092	0.091	6.884E-4	631	0.140	0.136	Q94LW1.pdb.gz	Q94LW1_MAIZE Two-component response regulator OS=Zea mays OX=4577 GN=ZmRR9 PE=2 SV=1
9	AFDB:Q8VIH1	0.048	0.053	1.710E-3	527	0.159	0.186	Q8VIH1.pdb.gz	NOBOX_MOUSE Homeobox protein NOBOX OS=Mus musculus OX=10090 GN=Nobox PE=1 SV=1
10	AFDB:Q9Z103	0.058	0.038	2.367E-3	1108	0.128	0.071	Q9Z103.pdb.gz	ADNP_MOUSE Activity-dependent neuroprotector homeobox protein OS=Mus musculus OX=10090 GN=Adnp PE=1 SV=2
11	AFDB:Q32MH5	0.055	0.036	7.146E-3	1076	0.132	0.075	Q32MH5.pdb.gz	ATOSA_HUMAN Atos homolog protein A OS=Homo sapiens OX=9606 GN=ATOSA PE=1 SV=2
12	AFDB:Q9ZWJ9	0.072	0.067	7.626E-3	664	0.133	0.123	Q9ZWJ9.pdb.gz	ARR2_ARATH Two-component response regulator ARR2 OS=Arabidopsis thaliana OX=3702 GN=ARR2 PE=1 SV=1
13	AFDB:Q58EM1	0.047	0.049	1.202E-2	582	0.137	0.144	Q58EM1.pdb.gz
14	PDB:7lsyY	0.077	0.057	6.463E-2	855	0.020	0.014	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
15	PDB:8dr5A	0.065	0.062	1.828E-1	646	0.015	0.014	8dr5A.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
16	PDB:1suwA	0.060	0.140	3.738E-1	249	0.016	0.040	1suwA.pdb.gz	Crystal Structures of an NAD Kinase from Archaeoglobus fulgidus in Complex with ATP, NAD, or NADP
17	PDB:1c2tA	0.047	0.117	4.256E-1	209	0.018	0.053	1c2tA.pdb.gz	New insights into inhibitor design from the crystal structure and NMR studies of Escherichia coli GAR transformylase in complex with beta-GAR and 10-formyl-5,8,10-trideazafolic acid.
18	PDB:1qo0E	0.064	0.183	4.542E-1	194	0.011	0.036	1qo0E.pdb.gz	Crystal Structure and Induction Mechanism of Amic-Amir: A Ligand-Regulated Transcription Antitermination Complex
19	PDB:8asnF	0.062	0.116	4.847E-1	317	0.007	0.013	8asnF.pdb.gz	Crystal structure of the apo human TTL in complex with tubulin-stathmin
20	PDB:6z4cA	0.097	0.337	5.173E-1	127	0.034	0.165	6z4cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NFT6	0.0	1252	615	1.000	1.000	DBF4B_HUMAN Protein DBF4 homolog B OS=Homo sapiens OX=9606 GN=DBF4B PE=1 SV=1
2	Q9QZ41	1.65e-46	176	663	0.189	0.175	DBF4A_MOUSE Protein DBF4 homolog A OS=Mus musculus OX=10090 GN=Dbf4 PE=1 SV=1
3	Q9UBU7	2.25e-44	170	674	0.189	0.172	DBF4A_HUMAN Protein DBF4 homolog A OS=Homo sapiens OX=9606 GN=DBF4 PE=1 SV=1
4	Q7ZZH7	1.13e-40	159	661	0.174	0.162	DBF4A_XENLA Protein DBF4 homolog A OS=Xenopus laevis OX=8355 GN=dbf4 PE=1 SV=1
5	Q9NK54	5.53e-09	62.0	1711	0.138	0.050	CHIF_DROME Protein chiffon OS=Drosophila melanogaster OX=7227 GN=chif PE=1 SV=2
6	C8VPD7	1.55e-04	47.4	647	0.029	0.028	C8VPD7_EMENI G1/S regulator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01779 PE=4 SV=1
7	O59836	0.003	43.1	545	0.026	0.029	HIM1_SCHPO Hsk1-interacting molecule 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=him1 PE=1 SV=1
8	Q5A5B4	0.014	40.8	506	0.023	0.028	Q5A5B4_CANAL Protein serine/threonine kinase activating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DBF4 PE=4 SV=1
9	P32325	0.12	37.7	704	0.026	0.023	DBF4_YEAST DDK kinase regulatory subunit DBF4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBF4 PE=1 SV=2
10	Q9Y7J1	1.3	34.3	474	0.024	0.032	SPO6_SCHPO Sporulation-specific protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spo6 PE=4 SV=1
11	O88379	7.5	32.3	1555	0.039	0.015	BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus OX=10090 GN=Baz1a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	23	16.7	BRCA1 C Terminus (BRCT) domain
2	PF07535 zf-DBF	6.6e-14	63.0	DBF zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393139	0.995	Cell division cycle 7-related protein kinase
2	9606.ENSP00000372023	0.863	Serine/threonine-protein kinase Chk2
3	9606.ENSP00000307288	0.841	DNA replication licensing factor MCM7
4	9606.ENSP00000265056	0.836	DNA replication licensing factor MCM2
5	9606.ENSP00000262105	0.801	DNA replication licensing factor MCM4
6	9606.ENSP00000268138	0.796	Treslin
7	9606.ENSP00000418268	0.786	Protein MCM10 homolog
8	9606.ENSP00000253410	0.782	HIG1 hypoxia inducible domain family member 1B
9	9606.ENSP00000405726	0.774	Cell division control protein 45 homolog
10	9606.ENSP00000312995	0.757	Claspin
11	9606.ENSP00000200557	0.743	Disintegrin and metalloproteinase domain-containing protein 11
12	9606.ENSP00000216122	0.731	DNA replication licensing factor MCM5
13	9606.ENSP00000264156	0.728	DNA replication licensing factor MCM6
14	9606.ENSP00000265140	0.726	SMC5-SMC6 complex localization factor protein 1
15	9606.ENSP00000209728	0.724	Cell division control protein 6 homolog
16	9606.ENSP00000465992	0.719	Kinesin-like protein KIF18B
17	9606.ENSP00000301019	0.716	DNA replication factor Cdt1
18	9606.ENSP00000359181	0.691	DNA polymerase lambda
19	9606.ENSP00000260810	0.681	DNA topoisomerase 2-binding protein 1
20	9606.ENSP00000265728	0.652	Protein DBF4 homolog A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0030295	1.000	protein kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0010564	0.990	regulation of cell cycle process
GO:0051052	0.988	regulation of DNA metabolic process
GO:0006275	0.983	regulation of DNA replication
GO:1901990	0.980	regulation of mitotic cell cycle phase transition
GO:0031325	0.976	positive regulation of cellular metabolic process
GO:0090068	0.975	positive regulation of cell cycle process
GO:0090329	0.972	regulation of DNA-templated DNA replication
GO:0010389	0.969	regulation of G2/M transition of mitotic cell cycle
GO:0051054	0.966	positive regulation of DNA metabolic process
GO:0045931	0.965	positive regulation of mitotic cell cycle
GO:1901992	0.961	positive regulation of mitotic cell cycle phase transition
GO:0042127	0.940	regulation of cell population proliferation
GO:2000105	0.931	positive regulation of DNA-templated DNA replication
GO:1902751	0.922	positive regulation of cell cycle G2/M phase transition
GO:0010971	0.848	positive regulation of G2/M transition of mitotic cell cycle
GO:0008284	0.788	positive regulation of cell population proliferation
GO:0009987	0.726	cellular process
GO:0071704	0.653	organic substance metabolic process
GO:0044238	0.635	primary metabolic process
GO:0044237	0.619	cellular metabolic process
GO:0006807	0.617	nitrogen compound metabolic process
GO:0043170	0.595	macromolecule metabolic process
GO:0044260	0.379	cellular macromolecule metabolic process
GO:0034641	0.377	cellular nitrogen compound metabolic process
GO:1901360	0.375	organic cyclic compound metabolic process
GO:0046483	0.375	heterocycle metabolic process
GO:0006725	0.375	cellular aromatic compound metabolic process
GO:0006259	0.374	DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0043232	0.537	intracellular non-membrane-bounded organelle
GO:0032991	0.478	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]