StarFunc result for job id Q8NFU3

User Input

>input (115 residues)
MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQ
ALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFU3	1.000	1.000	5.436E-25	115	1.000	1.000	Q8NFU3.pdb.gz	TSTD1_HUMAN Thiosulfate:glutathione sulfurtransferase OS=Homo sapiens OX=9606 GN=TSTD1 PE=1 SV=3
2	PDB:6bevB	0.956	0.965	1.702E-22	114	0.991	1.000	6bevB.pdb.gz
3	AFDB:E9PY03	0.984	0.852	9.010E-22	133	0.835	0.722	E9PY03.pdb.gz	E9PY03_MOUSE Thiosulfate sulfurtransferase (rhodanese)-like domain containing 1 OS=Mus musculus OX=10090 GN=Tstd1 PE=1 SV=1
4	AFDB:Q382H6	0.877	0.741	2.188E-10	137	0.339	0.285	Q382H6.pdb.gz	Q382H6_TRYB2 Rhodanese domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5195 PE=4 SV=1
5	AFDB:Q08742	0.865	0.681	2.864E-10	149	0.330	0.255	Q08742.pdb.gz	RDL2_YEAST Thiosulfate sulfurtransferase RDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RDL2 PE=1 SV=1
6	AFDB:Q382H5	0.915	0.741	2.864E-10	143	0.339	0.273	Q382H5.pdb.gz	Q382H5_TRYB2 Rhodanese domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5200 PE=4 SV=1
7	PDB:3d1pA	0.808	0.778	5.351E-10	120	0.270	0.258	3d1pA.pdb.gz
8	AFDB:Q12305	0.825	0.696	1.444E-9	139	0.270	0.223	Q12305.pdb.gz	RDL1_YEAST Thiosulfate:glutathione sulfurtransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RDL1 PE=1 SV=1
9	AFDB:Q10215	0.890	0.727	1.890E-9	142	0.287	0.232	Q10215.pdb.gz	RDL_SCHPO Putative thiosulfate sulfurtransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.07c PE=3 SV=2
10	PDB:6k6rA	0.841	0.791	2.203E-9	123	0.330	0.309	6k6rA.pdb.gz
11	PDB:6hivDT	0.857	0.428	6.928E-9	239	0.217	0.105	6hivDT.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
12	AFDB:Q586G5	0.802	0.394	1.747E-8	247	0.209	0.097	Q586G5.pdb.gz	Q586G5_TRYB2 Rhodanese domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.30P15.560 PE=1 SV=1
13	AFDB:O95396	0.735	0.205	2.589E-7	460	0.252	0.063	O95396.pdb.gz	MOCS3_HUMAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Homo sapiens OX=9606 GN=MOCS3 PE=1 SV=1
14	AFDB:P9WMN7	0.730	0.228	3.169E-7	392	0.278	0.082	P9WMN7.pdb.gz	MOEZ_MYCTU Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moeZ PE=1 SV=1
15	PDB:4jgtA	0.732	0.322	6.774E-7	280	0.235	0.096	4jgtA.pdb.gz	Structure and Kinetic Analysis of H2S Production by Human Mercaptopyruvate Sulfurtransferase.
16	PDB:8agfA	0.674	0.296	1.861E-6	290	0.243	0.097	8agfA.pdb.gz
17	PDB:1dp2A	0.725	0.305	4.179E-6	293	0.226	0.089	1dp2A.pdb.gz
18	PDB:5wqkA	0.722	0.306	5.853E-6	293	0.235	0.092	5wqkA.pdb.gz	Discovery and Mechanistic Characterization of Selective Inhibitors of H2S-producing Enzyme: 3-Mercaptopyruvate Sulfurtransferase (3MST) Targeting Active-site Cysteine Persulfide
19	PDB:3hzuA	0.655	0.282	2.758E-5	292	0.287	0.113	3hzuA.pdb.gz
20	PDB:1h4kX	0.658	0.306	4.420E-5	271	0.261	0.111	1h4kX.pdb.gz	A Persulfurated Cysteine Promotes Active Site Reactivity in Azotobacter Vinelandii Rhodanse

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NFU3	4.77e-80	232	115	1.000	1.000	TSTD1_HUMAN Thiosulfate:glutathione sulfurtransferase OS=Homo sapiens OX=9606 GN=TSTD1 PE=1 SV=3
2	E9PY03	1.81e-67	201	133	0.835	0.722	E9PY03_MOUSE Thiosulfate sulfurtransferase (rhodanese)-like domain containing 1 OS=Mus musculus OX=10090 GN=Tstd1 PE=1 SV=1
3	F7FDQ5	8.95e-66	196	124	0.817	0.758	F7FDQ5_RAT Upstream transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Usf1 PE=1 SV=1
4	Q382H5	2.85e-17	73.9	143	0.391	0.315	Q382H5_TRYB2 Rhodanese domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5200 PE=4 SV=1
5	Q10215	3.50e-16	71.2	142	0.278	0.225	RDL_SCHPO Putative thiosulfate sulfurtransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.07c PE=3 SV=2
6	Q382H6	3.74e-14	65.9	137	0.304	0.255	Q382H6_TRYB2 Rhodanese domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5195 PE=4 SV=1
7	Q08742	8.51e-14	65.1	149	0.330	0.255	RDL2_YEAST Thiosulfate sulfurtransferase RDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RDL2 PE=1 SV=1
8	Q12305	1.68e-12	61.6	139	0.261	0.216	RDL1_YEAST Thiosulfate:glutathione sulfurtransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RDL1 PE=1 SV=1
9	B2C7Y6	1.51e-09	54.7	185	0.313	0.195	B2C7Y6_NICBE Chloroplast N receptor-interacting protein 1 OS=Nicotiana benthamiana OX=4100 GN=NRIP1 PE=1 SV=1
10	Q8RUD6	4.46e-09	53.1	169	0.296	0.201	HARC1_ARATH Protein HIGH ARSENIC CONTENT 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HAC1 PE=1 SV=1
11	Q39129	9.08e-09	51.6	120	0.270	0.258	STR16_ARATH Thiosulfate sulfurtransferase 16, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STR16 PE=1 SV=2
12	O53921	1.32e-06	47.0	218	0.287	0.151	O53921_MYCTU Probable transcriptional regulatory protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1674c PE=1 SV=1
13	P52197	1.53e-05	44.3	271	0.304	0.129	THTR_AZOVI Thiosulfate sulfurtransferase OS=Azotobacter vinelandii OX=354 GN=rhdA PE=1 SV=1
14	Q9FKW8	3.12e-05	42.4	136	0.287	0.243	STR18_ARATH Thiosulfate sulfurtransferase 18 OS=Arabidopsis thaliana OX=3702 GN=STR18 PE=1 SV=1
15	Q9HUK9	1.06e-04	42.0	271	0.287	0.122	THTR_PSEAE Thiosulfate sulfurtransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=rhdA PE=1 SV=1
16	F4JZ39	1.64e-04	40.4	138	0.296	0.246	F4JZ39_ARATH Sulfurtransferase 18 OS=Arabidopsis thaliana OX=3702 GN=STR18 PE=1 SV=1
17	P9WHF7	2.45e-04	40.8	297	0.287	0.111	THT2_MYCTU Putative thiosulfate sulfurtransferase SseA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sseA PE=1 SV=1
18	Q38853	3.15e-04	40.4	182	0.217	0.137	STR15_ARATH Rhodanese-like domain-containing protein 15, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STR15 PE=2 SV=1
19	P25325	0.003	37.7	297	0.235	0.091	THTM_HUMAN 3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST PE=1 SV=3
20	Q586G5	0.004	37.4	247	0.191	0.089	Q586G5_TRYB2 Rhodanese domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.30P15.560 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13443 HTH_26	3.6e+02	13.0	Cro/C1-type HTH DNA-binding domain
2	PF00581 Rhodanese	3.7e-12	58.1	Rhodanese-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388293

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385828	0.754	Thiosulfate sulfurtransferase
2	9606.ENSP00000260324	0.631	Sulfide:quinone oxidoreductase, mitochondrial
3	9606.ENSP00000352706	0.621	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial
4	9606.ENSP00000380402	0.621	3-mercaptopyruvate sulfurtransferase
5	9606.ENSP00000386284	0.553	Delta-aminolevulinic acid dehydratase
6	9606.ENSP00000390011	0.542	Cytoplasmic tRNA 2-thiolation protein 1
7	9606.ENSP00000359976	0.532	Cystathionine gamma-lyase
8	9606.ENSP00000434516	0.510	Thioredoxin reductase 1, cytoplasmic
9	9606.ENSP00000361795	0.507	Dysbindin domain-containing protein 2
10	9606.ENSP00000338173	0.502	Pumilio homolog 2
11	9606.ENSP00000391723	0.502	Pumilio homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016783	1.000	sulfurtransferase activity
GO:0005488	0.945	binding
GO:0005515	0.932	protein binding
GO:0004792	0.514	thiosulfate sulfurtransferase activity
GO:1901363	0.353	heterocyclic compound binding
GO:0097159	0.353	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0006790	0.981	sulfur compound metabolic process
GO:0071704	0.804	organic substance metabolic process
GO:0044238	0.687	primary metabolic process
GO:0050789	0.356	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.995	cytosol
GO:0070013	0.975	intracellular organelle lumen
GO:0043232	0.970	intracellular non-membrane-bounded organelle
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0035770	0.763	ribonucleoprotein granule
GO:0036464	0.753	cytoplasmic ribonucleoprotein granule
GO:0005634	0.673	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.8.1.-	1.000	Sulfurtransferases.
RHEA:16881	0.514	hydrogen cyanide + thiosulfate = 2 H(+) + sulfite + thiocyanate
EC:2.8.1.1	0.514	thiosulfate sulfurtransferase.

[back to server]