StarFunc result for job id Q8NFU7

User Input

>input (2136 residues)
MSRSRHARPSRLVRKEDVNKKKKNSQLRKTTKGANKNVASVKTLSPGKLKQLIQERDVKK
KTEPKPPVPVRSLLTRAGAARMNLDRTEVLFQNPESLTCNGFTMALRSTSLSRRLSQPPL
VVAKSKKVPLSKGLEKQHDCDYKILPALGVKHSENDSVPMQDTQVLPDIETLIGVQNPSL
LKGKSQETTQFWSQRVEDSKINIPTHSGPAAEILPGPLEGTRCGEGLFSEETLNDTSGSP
KMFAQDTVCAPFPQRATPKVTSQGNPSIQLEELGSRVESLKLSDSYLDPIKSEHDCYPTS
SLNKVIPDLNLRNCLALGGSTSPTSVIKFLLAGSKQATLGAKPDHQEAFEATANQQEVSD
TTSFLGQAFGAIPHQWELPGADPVHGEALGETPDLPEIPGAIPVQGEVFGTILDQQETLG
MSGSVVPDLPVFLPVPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSS
SNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSK
SDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTTLLPTLEKKKRKRCGVCEPCQQK
TNCGECTYCKNRKNSHQICKKRKCEELKKKPSVVVPLEVIKENKRPQREKKPKVLKADFD
NKPVNGPKSESMDYSRCGHGEEQKLELNPHTVENVTKNEDSMTGIEVEKWTQNKKSQLTD
HVKGDFSANVPEAEKSKNSEVDKKRTKSPKLFVQTVRNGIKHVHCLPAETNVSFKKFNIE
EFGKTLENNSYKFLKDTANHKNAMSSVATDMSCDHLKGRSNVLVFQQPGFNCSSIPHSSH
SIINHHASIHNEGDQPKTPENIPSKEPKDGSPVQPSLLSLMKDRRLTLEQVVAIEALTQL
SEAPSENSSPSKSEKDEESEQRTASLLNSCKAILYTVRKDLQDPNLQGEPPKLNHCPSLE
KQSSCNTVVFNGQTTTLSNSHINSATNQASTKSHEYSKVTNSLSLFIPKSNSSKIDTNKS
IAQGIITLDNCSNDLHQLPPRNNEVEYCNQLLDSSKKLDSDDLSCQDATHTQIEEDVATQ
LTQLASIIKINYIKPEDKKVESTPTSLVTCNVQQKYNQEKGTIQQKPPSSVHNNHGSSLT
KQKNPTQKKTKSTPSRDRRKKKPTVVSYQENDRQKWEKLSYMYGTICDIWIASKFQNFGQ
FCPHDFPTVFGKISSSTKIWKPLAQTRSIMQPKTVFPPLTQIKLQRYPESAEEKVKVEPL
DSLSLFHLKTESNGKAFTDKAYNSQVQLTVNANQKAHPLTQPSSPPNQCANVMAGDDQIR
FQQVVKEQLMHQRLPTLPGISHETPLPESALTLRNVNVVCSGGITVVSTKSEEEVCSSSF
GTSEFSTVDSAQKNFNDYAMNFFTNPTKNLVSITKDSELPTCSCLDRVIQKDKGPYYTHL
GAGPSVAAVREIMENRYGQKGNAIRIEIVVYTGKEGKSSHGCPIAKWVLRRSSDEEKVLC
LVRQRTGHHCPTAVMVVLIMVWDGIPLPMADRLYTELTENLKSYNGHPTDRRCTLNENRT
CTCQGIDPETCGASFSFGCSWSMYFNGCKFGRSPSPRRFRIDPSSPLHEKNLEDNLQSLA
TRLAPIYKQYAPVAYQNQVEYENVARECRLGSKEGRPFSGVTACLDFCAHPHRDIHNMNN
GSTVVCTLTREDNRSLGVIPQDEQLHVLPLYKLSDTDEFGSKEGMEAKIKSGAIEVLAPR
RKKRTCFTQPVPRSGKKRAAMMTEVLAHKIRAVEKKPIPRIKRKNNSTTTNNSKPSSLPT
LGSNTETVQPEVKSETEPHFILKSSDNTKTYSLMPSAPHPVKEASPGFSWSPKTASATPA
PLKNDATASCGFSERSSTPHCTMPSGRLSGANAAAADGPGISQLGEVAPLPTLSAPVMEP
LINSEPSTGVTEPLTPHQPNHQPSFLTSPQDLASSPMEEDEQHSEADEPPSDEPLSDDPL
SPAEEKLPHIDEYWSDSEHIFLDANIGGVAIAPAHGSVLIECARRELHATTPVEHPNRNH
PTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNE
LNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3URK3	0.271	0.286	0.000	2007	0.538	0.573	Q3URK3.pdb.gz	TET1_MOUSE Methylcytosine dioxygenase TET1 OS=Mus musculus OX=10090 GN=Tet1 PE=1 SV=3
2	AFDB:Q8NFU7	1.000	1.000	0.000	2136	1.000	1.000	Q8NFU7.pdb.gz	TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens OX=9606 GN=TET1 PE=1 SV=2
3	AFDB:F1R3C6	0.246	0.278	8.054E-99	1855	0.265	0.305	F1R3C6.pdb.gz	F1R3C6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet1 PE=2 SV=1
4	AFDB:Q6N021	0.222	0.235	1.639E-82	2002	0.265	0.282	Q6N021.pdb.gz	TET2_HUMAN Methylcytosine dioxygenase TET2 OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=3
5	AFDB:E7F958	0.218	0.268	5.860E-81	1715	0.232	0.289	E7F958.pdb.gz	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1
6	AFDB:D4AC33	0.202	0.224	1.637E-77	1920	0.244	0.271	D4AC33.pdb.gz	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
7	AFDB:Q4JK59	0.214	0.237	2.676E-76	1912	0.243	0.271	Q4JK59.pdb.gz	TET2_MOUSE Methylcytosine dioxygenase TET2 OS=Mus musculus OX=10090 GN=Tet2 PE=1 SV=3
8	AFDB:Q9VED3	0.024	0.037	9.378E-5	1186	0.071	0.128	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
9	AFDB:O35413	0.039	0.059	2.425E-4	1196	0.069	0.123	O35413.pdb.gz	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
10	AFDB:Q68FD9	0.033	0.035	5.607E-4	1940	0.111	0.123	Q68FD9.pdb.gz	K1549_MOUSE UPF0606 protein KIAA1549 OS=Mus musculus OX=10090 GN=Kiaa1549 PE=1 SV=3
11	PDB:4lt5A	0.071	0.448	1.216E-2	265	0.013	0.106	4lt5A.pdb.gz	Structure of a Naegleria Tet-like dioxygenase in complex with 5-methylcytosine DNA.
12	PDB:7cy6A	0.068	0.155	2.011E-2	872	0.014	0.034	7cy6A.pdb.gz	Molecular mechanism for vitamin C-derived C 5 -glyceryl-methylcytosine DNA modification catalyzed by algal TET homologue CMD1.
13	PDB:4ie6A	0.061	0.226	8.131E-2	447	0.013	0.063	4ie6A.pdb.gz	Structural basis for inhibition of the fat mass and obesity associated protein (FTO)
14	PDB:7cl4F	0.015	0.092	1.124	285	0.005	0.039	7cl4F.pdb.gz
15	PDB:2fdjA	0.052	0.375	1.486	207	0.010	0.101	2fdjA.pdb.gz	Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
16	PDB:5ei0A	0.026	0.076	1.572	372	0.008	0.046	5ei0A.pdb.gz
17	PDB:1jr7A	0.020	0.117	2.749	306	0.005	0.036	1jr7A.pdb.gz	Structural genomics: a pipeline for providing structures for the biologist.
18	PDB:7etlA	0.016	0.104	3.074	294	0.005	0.037	7etlA.pdb.gz	Structural Insight into the Catalytic Mechanism of the Endoperoxide Synthase FtmOx1.
19	PDB:3mguA	0.045	0.128	3.250	533	0.008	0.032	3mguA.pdb.gz	Structural and functional insights into S. cerevisiae Tpa1, a putative prolyl hydroxylase influencing translation termination and transcription
20	PDB:2rdnA	0.022	0.138	3.437	275	0.004	0.033	2rdnA.pdb.gz	Crystal Structure of the Non-heme Iron Dioxygenase PtlH in Pentalenolactone Biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R3C6	0.0	755	1855	0.265	0.306	F1R3C6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet1 PE=2 SV=1
2	Q3URK3	0.0	1977	2007	0.534	0.569	TET1_MOUSE Methylcytosine dioxygenase TET1 OS=Mus musculus OX=10090 GN=Tet1 PE=1 SV=3
3	Q8NFU7	0.0	4420	2136	1.000	1.000	TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens OX=9606 GN=TET1 PE=1 SV=2
4	Q6N021	2.52e-157	538	2002	0.125	0.133	TET2_HUMAN Methylcytosine dioxygenase TET2 OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=3
5	E7EQS8	3.44e-157	538	2023	0.125	0.132	E7EQS8_HUMAN Methylcytosine dioxygenase TET OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=1
6	Q8BG87	2.65e-149	512	1803	0.121	0.144	TET3_MOUSE Methylcytosine dioxygenase TET3 OS=Mus musculus OX=10090 GN=Tet3 PE=1 SV=4
7	O43151	3.49e-149	511	1795	0.131	0.155	TET3_HUMAN Methylcytosine dioxygenase TET3 OS=Homo sapiens OX=9606 GN=TET3 PE=1 SV=4
8	A0A2R8Q4R6	5.46e-146	505	2052	0.110	0.115	A0A2R8Q4R6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=si:ch211-220a11.1 PE=1 SV=1
9	E7F958	4.38e-143	492	1715	0.106	0.132	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1
10	D4AC33	1.69e-131	460	1920	0.099	0.110	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
11	Q4JK59	4.87e-129	452	1912	0.098	0.110	TET2_MOUSE Methylcytosine dioxygenase TET2 OS=Mus musculus OX=10090 GN=Tet2 PE=1 SV=3
12	M9NEY8	4.17e-101	367	2860	0.083	0.062	TET_DROME Methylcytosine dioxygenase TET OS=Drosophila melanogaster OX=7227 GN=Tet PE=1 SV=1
13	E7FC24	1.90e-17	87.4	283	0.026	0.194	E7FC24_DANRE CXXC finger protein 5a OS=Danio rerio OX=7955 GN=cxxc5a PE=4 SV=1
14	Q7LFL8	5.20e-17	86.7	322	0.019	0.124	CXXC5_HUMAN CXXC-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=CXXC5 PE=1 SV=1
15	Q0VFP6	2.04e-16	81.6	188	0.016	0.186	CXXC4_XENTR CXXC-type zinc finger protein 4 OS=Xenopus tropicalis OX=8364 GN=cxxc4 PE=2 SV=2
16	Q6NXI8	5.44e-16	80.9	198	0.016	0.177	CXXC4_MOUSE CXXC-type zinc finger protein 4 OS=Mus musculus OX=10090 GN=Cxxc4 PE=2 SV=1
17	Q9EQC9	5.44e-16	80.9	198	0.016	0.177	CXXC4_RAT CXXC-type zinc finger protein 4 OS=Rattus norvegicus OX=10116 GN=Cxxc4 PE=1 SV=1
18	Q9H2H0	5.44e-16	80.9	198	0.016	0.177	CXXC4_HUMAN CXXC-type zinc finger protein 4 OS=Homo sapiens OX=9606 GN=CXXC4 PE=1 SV=1
19	F1RCN0	7.20e-04	47.4	1500	0.013	0.019	F1RCN0_DANRE DNA (cytosine-5)-methyltransferase OS=Danio rerio OX=7955 GN=cb1075 PE=1 SV=1
20	P13864	0.001	46.6	1620	0.011	0.015	DNMT1_MOUSE DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus OX=10090 GN=Dnmt1 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12851 Tet_JBP	3.9e-140	478.6	Oxygenase domain of the 2OGFeDO superfamily
2	PF02008 zf-CXXC	6.2e-05	34.2	CXXC zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362748

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362824	0.995	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
2	9606.ENSP00000378402	0.992	Paired amphipathic helix protein Sin3a
3	9606.ENSP00000229307	0.989	Homeobox protein NANOG
4	9606.ENSP00000437955	0.940	Hypoxia-inducible factor 1-alpha
5	9606.ENSP00000376611	0.904	G/T mismatch-specific thymine DNA glycosylase
6	9606.ENSP00000287820	0.901	Peroxisome proliferator-activated receptor gamma
7	9606.ENSP00000250448	0.897	Hepatocyte nuclear factor 3-alpha
8	9606.ENSP00000352516	0.837	DNA (cytosine-5)-methyltransferase 1
9	9606.ENSP00000264709	0.828	DNA (cytosine-5)-methyltransferase 3A
10	9606.ENSP00000328547	0.825	DNA (cytosine-5)-methyltransferase 3B
11	9606.ENSP00000395535	0.805	Methyl-CpG-binding protein 2
12	9606.ENSP00000306561	0.791	N-glycosylase/DNA lyase
13	9606.ENSP00000319169	0.769	Protein arginine N-methyltransferase 5
14	9606.ENSP00000320147	0.759	Histone-lysine N-methyltransferase EZH2
15	9606.ENSP00000276594	0.743	PR domain zinc finger protein 14
16	9606.ENSP00000442788	0.724	Methylcytosine dioxygenase TET2
17	9606.ENSP00000259915	0.722	POU domain, class 5, transcription factor 1
18	9606.ENSP00000360025	0.712	Growth arrest and DNA damage-inducible protein GADD45 alpha
19	9606.ENSP00000386869	0.707	Methylcytosine dioxygenase TET3
20	9606.ENSP00000363314	0.704	Protein lin-28 homolog A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070579	1.000	methylcytosine dioxygenase activity
GO:0043565	0.999	sequence-specific DNA binding
GO:0008270	0.996	zinc ion binding
GO:1901265	0.986	nucleoside phosphate binding
GO:0008327	0.982	methyl-CpG binding
GO:0005506	0.969	iron ion binding
GO:0005515	0.911	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.994	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0050794	0.988	regulation of cellular process
GO:0044238	0.987	primary metabolic process
GO:0019222	0.986	regulation of metabolic process
GO:0010468	0.979	regulation of gene expression
GO:0006807	0.975	nitrogen compound metabolic process
GO:0048518	0.975	positive regulation of biological process
GO:0010604	0.969	positive regulation of macromolecule metabolic process
GO:0048522	0.968	positive regulation of cellular process
GO:0043170	0.964	macromolecule metabolic process
GO:0044237	0.955	cellular metabolic process
GO:0048523	0.939	negative regulation of cellular process
GO:0006304	0.922	DNA modification
GO:0070988	0.916	demethylation
GO:1902275	0.916	regulation of chromatin organization
GO:0035510	0.885	DNA dealkylation
GO:0051171	0.818	regulation of nitrogen compound metabolic process
GO:0080090	0.816	regulation of primary metabolic process
GO:0031323	0.810	regulation of cellular metabolic process
GO:0019219	0.721	regulation of nucleobase-containing compound metabolic process
GO:0042127	0.680	regulation of cell population proliferation
GO:0009889	0.679	regulation of biosynthetic process
GO:0010556	0.669	regulation of macromolecule biosynthetic process
GO:0031326	0.632	regulation of cellular biosynthetic process
GO:0051252	0.612	regulation of RNA metabolic process
GO:0120261	0.554	regulation of heterochromatin organization
GO:0006355	0.491	regulation of DNA-templated transcription
GO:0051173	0.431	positive regulation of nitrogen compound metabolic process
GO:0010628	0.415	positive regulation of gene expression
GO:0031445	0.386	regulation of heterochromatin formation
GO:0031325	0.380	positive regulation of cellular metabolic process
GO:0050896	0.373	response to stimulus
GO:0045935	0.349	positive regulation of nucleobase-containing compound metabolic process
GO:0008284	0.331	positive regulation of cell population proliferation
GO:0006357	0.329	regulation of transcription by RNA polymerase II
GO:0051716	0.309	cellular response to stimulus
GO:0010557	0.308	positive regulation of macromolecule biosynthetic process
GO:0031328	0.302	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.978	nucleoplasm
GO:0005737	0.646	cytoplasm
GO:0032991	0.578	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:52636	1.000	2-oxoglutarate + a 5-methyl-2'-deoxycytidine in DNA + O2 = a 5-hydroxymethyl-2'-deoxycytidine in DNA + CO2 + succinate
EC:1.14.11.n2	1.000	Transferred entry: 1.14.11.80.

[back to server]