StarFunc result for job id Q8NFV5

User Input

>input (336 residues)
MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVETLC
GLKMKLKQQRVSPILLEHHKDFNSQLAPGVDPSPPHRSFCWKRKMEWWDKSEESEEEPRK
VLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVS
DKYLLAMVIAYFSRAGFPSWQYQRLHFFLALYLANDMEEDDEDSKQNIFHFLYGKNRSRI
PLLRKRRFQLYRSMNPRARKNRSHIPLVRKRRFQLRRCMNPRARKNRSQIVLFQKRRFHF
FCSMSCRAWVSPEELEEIQAYDPEHWVWARDRARLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DTA3	0.488	0.610	1.933E-25	265	0.557	0.706	P0DTA3.pdb.gz	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
2	AFDB:A6NLX3	0.455	0.635	1.075E-22	237	0.443	0.629	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
3	AFDB:Q5IBH6	0.477	0.591	9.684E-22	268	0.396	0.496	Q5IBH6.pdb.gz	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
4	AFDB:Q9YGL1	0.401	0.450	5.277E-13	298	0.229	0.258	Q9YGL1.pdb.gz	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
5	AFDB:Q9PU13	0.403	0.452	1.499E-12	299	0.232	0.261	Q9PU13.pdb.gz	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
6	AFDB:A0A384MTT5	0.398	0.427	2.761E-11	313	0.182	0.195	A0A384MTT5.pdb.gz	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
7	AFDB:Q5MJ68	0.414	0.472	1.789E-10	293	0.205	0.235	Q5MJ68.pdb.gz	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
8	AFDB:Q5IBH7	0.407	0.440	4.103E-9	310	0.199	0.216	Q5IBH7.pdb.gz	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
9	AFDB:Q9XIL5	0.103	0.061	2.481E-1	849	0.134	0.053	Q9XIL5.pdb.gz	PP154_ARATH Pentatricopeptide repeat-containing protein At2g15820, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OTP51 PE=2 SV=3
10	AFDB:Q6RCE1	0.094	0.061	5.356E-1	641	0.152	0.080	Q6RCE1.pdb.gz	IFT74_CHLRE Intraflagellar transport protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT74 PE=1 SV=1
11	PDB:3g33B	0.146	0.202	1.880	229	0.104	0.153	3g33B.pdb.gz
12	PDB:6upnA	0.105	0.132	2.615	245	0.071	0.098	6upnA.pdb.gz
13	PDB:6jt0A	0.082	0.056	2.762	542	0.027	0.017	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
14	PDB:1o0lA	0.102	0.166	2.918	188	0.039	0.069	1o0lA.pdb.gz
15	PDB:7c4jB	0.098	0.085	3.083	395	0.095	0.081	7c4jB.pdb.gz
16	PDB:1zp2A	0.236	0.332	3.257	227	0.060	0.088	1zp2A.pdb.gz
17	PDB:3bviF	0.123	0.184	3.257	173	0.060	0.116	3bviF.pdb.gz	Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
18	PDB:6kvgA	0.155	0.197	3.442	256	0.042	0.055	6kvgA.pdb.gz
19	PDB:1sqfA	0.151	0.126	3.636	425	0.045	0.035	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
20	PDB:3f29B	0.091	0.065	3.636	520	0.060	0.038	3f29B.pdb.gz	Binding of sulfite by the Thioalkalivibrio nitratireducens cytochrome c nitrite reductase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CI01	0.0	567	402	0.920	0.769	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
2	Q495Y8	0.0	572	402	0.926	0.774	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
3	P0DTA3	1.36e-119	347	265	0.545	0.691	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
4	A6NLX3	2.00e-80	246	237	0.432	0.612	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
5	Q5IBH6	8.38e-71	223	268	0.369	0.463	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
6	Q9PU13	7.79e-21	93.2	299	0.226	0.254	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
7	Q9YGL1	5.55e-20	90.5	298	0.196	0.221	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
8	Q5MJ68	2.28e-17	83.2	293	0.146	0.167	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
9	Q5IBH7	5.45e-15	76.6	310	0.170	0.184	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
10	Q4R1K5	7.40e-15	76.3	311	0.146	0.158	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
11	A0A384MTT5	1.28e-14	75.5	313	0.143	0.153	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
12	Q5MJ70	1.28e-14	75.5	313	0.143	0.153	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
13	Q9NYB0	0.092	37.0	399	0.196	0.165	TE2IP_HUMAN Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1
14	Q9HXE4	0.63	33.9	315	0.051	0.054	DAUB_PSEAE NAD(P)H-dependent anabolic L-arginine dehydrogenase DauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=dauB PE=1 SV=1
15	A3RMR8	1.6	33.1	2474	0.095	0.013	A3RMR8_CHIKV Polyprotein P1234 OS=Chikungunya virus OX=37124 GN=CHIKVgp1 PE=4 SV=1
16	A4L7I2	1.6	33.1	2474	0.095	0.013	A4L7I2_CHIKV Polyprotein P1234 OS=Chikungunya virus OX=37124 GN=CHIKVgp1 PE=4 SV=1
17	A4L7I4	1.6	33.1	2474	0.095	0.013	A4L7I4_CHIKV Polyprotein P1234 OS=Chikungunya virus OX=37124 GN=CHIKVgp1 PE=4 SV=1
18	P03317	1.9	33.1	2513	0.060	0.008	POLN_SINDV Polyprotein P1234 OS=Sindbis virus OX=11034 PE=1 SV=2
19	A0A1D8PRQ6	3.1	32.3	1468	0.036	0.008	A0A1D8PRQ6_CANAL Lrg1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LRG1 PE=4 SV=1
20	Q8JUX6	3.6	32.0	2474	0.060	0.008	POLN_CHIKS Polyprotein P1234 OS=Chikungunya virus (strain S27-African prototype) OX=371094 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11357 Spy1	2.8e-54	194.4	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258704

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378699	0.880	Cyclin-dependent kinase 1
2	9606.ENSP00000266970	0.804	Cyclin-dependent kinase 2
3	9606.ENSP00000485271	0.709	annotation not available
4	9606.ENSP00000321656	0.600	M-phase inducer phosphatase 3
5	9606.ENSP00000392726	0.522	POM121-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.985	regulation of metabolic process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0051726	0.964	regulation of cell cycle
GO:0048518	0.961	positive regulation of biological process
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0048522	0.950	positive regulation of cellular process
GO:0080090	0.941	regulation of primary metabolic process
GO:0051246	0.924	regulation of protein metabolic process
GO:0009987	0.872	cellular process
GO:0051174	0.635	regulation of phosphorus metabolic process
GO:0001932	0.497	regulation of protein phosphorylation
GO:0045787	0.493	positive regulation of cell cycle
GO:0065009	0.476	regulation of molecular function
GO:0009893	0.454	positive regulation of metabolic process
GO:0008152	0.448	metabolic process
GO:1904029	0.446	regulation of cyclin-dependent protein kinase activity
GO:0031325	0.441	positive regulation of cellular metabolic process
GO:0000079	0.396	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0051173	0.364	positive regulation of nitrogen compound metabolic process
GO:0010604	0.341	positive regulation of macromolecule metabolic process
GO:0071704	0.319	organic substance metabolic process
GO:0022414	0.317	reproductive process
GO:0022402	0.314	cell cycle process
GO:0050896	0.301	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0005737	0.991	cytoplasm
GO:0005654	0.988	nucleoplasm
GO:0005829	0.903	cytosol
GO:0043232	0.737	intracellular non-membrane-bounded organelle
GO:0005730	0.380	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]