StarFunc result for job id Q8NFY4

User Input

>input (1073 residues)
MRVFLLCAYILLLMVSQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQ
LMLKIRDTLYIAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHN
FIKVFVPRNDEMVFVCGTNAFNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALFAD
GKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREI
AVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSI
TDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPED
KVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYR
LTAISVDHSAGPYQNYTVIFVGSEAGMVLKVLAKTSPFSLNDSVLLEEIEAYNHAKCSAE
NEEDKKVISLQLDKDHHALYVAFSSCIIRIPLSRCERYGSCKKSCIASRDPYCGWLSQGS
CGRVTPGMLAEGYEQDTEFGNTAHLGDCHEILPTSTTPDYKIFGGPTSDMEVSSSSVTTM
ASIPEITPKVIDTWRPKLTSSRKFVVQDDPNTSDFTDPLSGIPKGVRWEVQSGESNQMVH
MNVLITCVFAAFVLGAFIAGVAVYCYRDMFVRKNRKIHKDAESAQSCTDSSGSFAKLNGL
FDSPVKEYQQNIDSPKLYSNLLTSRKELPPNGDTKSMVMDHRGQPPELAALPTPESTPVL
HQKTLQAMKSHSEKAHGHGASRKETPQFFPSSPPPHSPLSHGHIPSAIVLPNATHDYNTS
FSNSNAHKAEKKLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDI
QMAHQNLMLDPMGSMSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPGVPMTSLER
QRGYHKNSSQRHSISAMPKNLNSPNGVLLSRQPSMNRGGYMPTPTGAKVDYIQGTPVSVH
LQPSLSRQSSYTSNGTLPRTGLKRTPSLKPDVPPKPSFVPQTPSVRPLNKYTY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q76KF0	0.626	0.626	0.000	1073	0.948	0.948	Q76KF0.pdb.gz	SEM6D_MOUSE Semaphorin-6D OS=Mus musculus OX=10090 GN=Sema6d PE=1 SV=1
2	AFDB:E3W9A6	0.554	0.558	6.493E-104	1064	0.455	0.459	E3W9A6.pdb.gz	E3W9A6_DANRE Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6E OS=Danio rerio OX=7955 GN=bZ1N7.1 PE=2 SV=1
3	AFDB:O35464	0.531	0.551	7.738E-102	1031	0.451	0.469	O35464.pdb.gz	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
4	AFDB:Q9WTM3	0.508	0.583	6.170E-85	931	0.373	0.430	Q9WTM3.pdb.gz	SEM6C_MOUSE Semaphorin-6C OS=Mus musculus OX=10090 GN=Sema6c PE=2 SV=1
5	AFDB:Q9WTL3	0.522	0.581	7.364E-84	960	0.369	0.412	Q9WTL3.pdb.gz	SEM6C_RAT Semaphorin-6C OS=Rattus norvegicus OX=10116 GN=Sema6c PE=2 SV=1
6	AFDB:Q9H3T2	0.503	0.578	9.135E-84	930	0.350	0.404	Q9H3T2.pdb.gz	SEM6C_HUMAN Semaphorin-6C OS=Homo sapiens OX=9606 GN=SEMA6C PE=2 SV=4
7	PDB:6qp7A	0.419	0.714	5.464E-49	620	0.168	0.290	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
8	AFDB:Q1RMY5	0.343	0.678	2.971E-48	537	0.212	0.423	Q1RMY5.pdb.gz	Q1RMY5_HUMAN SEMA6C protein OS=Homo sapiens OX=9606 GN=SEMA6C PE=1 SV=1
9	PDB:3nvqA	0.376	0.667	2.048E-32	588	0.120	0.219	3nvqA.pdb.gz
10	PDB:3nvnA	0.305	0.799	3.784E-20	383	0.074	0.206	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
11	PDB:6vxkB	0.278	0.385	2.455E-13	747	0.079	0.114	6vxkB.pdb.gz
12	AFDB:M9PB01	0.204	0.099	6.876E-7	2397	0.125	0.056	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
13	PDB:1pguB	0.113	0.182	1.510E-6	608	0.062	0.109	1pguB.pdb.gz	The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
14	PDB:7mq8LR	0.120	0.153	1.977E-6	773	0.045	0.062	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	AFDB:P25365	0.188	0.190	2.376E-6	1065	0.120	0.121	P25365.pdb.gz	SED4_YEAST Putative guanine nucleotide-exchange factor SED4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SED4 PE=1 SV=1
16	AFDB:Q389F7	0.208	0.203	5.332E-6	1105	0.125	0.121	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
17	PDB:5c2vB	0.217	0.583	6.470E-6	352	0.043	0.131	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
18	PDB:5wyjBA	0.109	0.149	6.828E-6	755	0.048	0.069	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
19	PDB:6jp6A	0.173	0.185	7.606E-6	998	0.036	0.039	6jp6A.pdb.gz
20	PDB:7d4iBE	0.097	0.112	8.471E-6	890	0.036	0.044	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E3W9A6	0.0	888	1064	0.467	0.471	E3W9A6_DANRE Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6E OS=Danio rerio OX=7955 GN=bZ1N7.1 PE=2 SV=1
2	O35464	0.0	874	1031	0.455	0.473	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
3	O54951	0.0	632	886	0.275	0.333	SEM6B_MOUSE Semaphorin-6B OS=Mus musculus OX=10090 GN=Sema6b PE=1 SV=1
4	Q6P7E1	0.0	819	968	0.432	0.478	Q6P7E1_DANRE Semaphorin-6A precursor OS=Danio rerio OX=7955 GN=zgc:66106 PE=2 SV=1
5	Q76KF0	0.0	2067	1073	0.949	0.949	SEM6D_MOUSE Semaphorin-6D OS=Mus musculus OX=10090 GN=Sema6d PE=1 SV=1
6	Q8NFY4	0.0	2243	1073	1.000	1.000	SEM6D_HUMAN Semaphorin-6D OS=Homo sapiens OX=9606 GN=SEMA6D PE=1 SV=1
7	Q9H2E6	0.0	882	1030	0.465	0.484	SEM6A_HUMAN Semaphorin-6A OS=Homo sapiens OX=9606 GN=SEMA6A PE=1 SV=3
8	Q9H3T2	0.0	605	930	0.267	0.309	SEM6C_HUMAN Semaphorin-6C OS=Homo sapiens OX=9606 GN=SEMA6C PE=2 SV=4
9	Q9H3T3	0.0	626	888	0.274	0.331	SEM6B_HUMAN Semaphorin-6B OS=Homo sapiens OX=9606 GN=SEMA6B PE=1 SV=4
10	Q9WTL3	0.0	605	960	0.317	0.354	SEM6C_RAT Semaphorin-6C OS=Rattus norvegicus OX=10116 GN=Sema6c PE=2 SV=1
11	Q9WTM3	0.0	607	931	0.269	0.310	SEM6C_MOUSE Semaphorin-6C OS=Mus musculus OX=10090 GN=Sema6c PE=2 SV=1
12	Q1RMY5	9.43e-139	430	537	0.185	0.369	Q1RMY5_HUMAN SEMA6C protein OS=Homo sapiens OX=9606 GN=SEMA6C PE=1 SV=1
13	H0YMP7	5.57e-128	389	198	0.172	0.934	H0YMP7_HUMAN Semaphorin 6D (Fragment) OS=Homo sapiens OX=9606 GN=SEMA6D PE=1 SV=1
14	Q24322	1.07e-104	351	899	0.197	0.235	SEM1A_DROME Semaphorin-1A OS=Drosophila melanogaster OX=7227 GN=Sema1a PE=1 SV=3
15	O44253	3.20e-102	341	770	0.185	0.257	O44253_DROME Similar to semaphorin-I OS=Drosophila melanogaster OX=7227 GN=Sema1b PE=2 SV=1
16	Q7KK54	5.68e-102	340	770	0.183	0.255	Q7KK54_DROME MIP07328p OS=Drosophila melanogaster OX=7227 GN=Sema1b PE=1 SV=1
17	Q90663	7.33e-101	337	761	0.186	0.263	SEM3D_CHICK Semaphorin-3D OS=Gallus gallus OX=9031 GN=SEMA3D PE=2 SV=1
18	Q8BH34	1.27e-96	326	777	0.186	0.257	SEM3D_MOUSE Semaphorin-3D OS=Mus musculus OX=10090 GN=Sema3d PE=1 SV=1
19	Q9W6G6	4.77e-93	316	764	0.185	0.259	SEM3D_DANRE Semaphorin-3D OS=Danio rerio OX=7955 GN=sema3d PE=2 SV=1
20	Q14563	1.02e-92	315	771	0.177	0.246	SEM3A_HUMAN Semaphorin-3A OS=Homo sapiens OX=9606 GN=SEMA3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02433 FixO	5.2e+02	11.5	Cytochrome C oxidase, mono-heme subunit/FixO
2	PF01437 PSI	0.0088	27.9	Plexin repeat
3	PF01403 Sema	8.5e-45	164.3	Sema domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324857

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442736	0.927	Plexin-B3
2	9606.ENSP00000368314	0.912	Neuronal cell adhesion molecule
3	9606.ENSP00000377061	0.889	Plexin-A1
4	9606.ENSP00000258526	0.886	Plexin-C1
5	9606.ENSP00000317128	0.886	Plexin-D1
6	9606.ENSP00000265371	0.793	Neuropilin-1
7	9606.ENSP00000262629	0.767	TYRO protein tyrosine kinase-binding protein
8	9606.ENSP00000173229	0.761	Netrin-1
9	9606.ENSP00000353582	0.756	Neuropilin-2
10	9606.ENSP00000362205	0.746	Triggering receptor expressed on myeloid cells 2
11	9606.ENSP00000328551	0.704	Ras-related protein Rab-28
12	9606.ENSP00000352882	0.674	Plexin-A4
13	9606.ENSP00000356000	0.670	Plexin-A2
14	9606.ENSP00000332164	0.667	Slit homolog 3 protein
15	9606.ENSP00000295902	0.662	Prickle planar cell polarity protein 2
16	9606.ENSP00000263923	0.650	Vascular endothelial growth factor receptor 2
17	9606.ENSP00000358696	0.645	Plexin-A3
18	9606.ENSP00000417335	0.623	Roundabout homolog 2
19	9606.ENSP00000422591	0.621	Slit homolog 2 protein
20	9606.ENSP00000281321	0.619	POU domain, class 4, transcription factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0030215	0.993	semaphorin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.983	regulation of cellular process
GO:0032501	0.980	multicellular organismal process
GO:0009987	0.980	cellular process
GO:0048856	0.978	anatomical structure development
GO:0048519	0.974	negative regulation of biological process
GO:0007275	0.968	multicellular organism development
GO:0016043	0.967	cellular component organization
GO:0050896	0.945	response to stimulus
GO:0007154	0.944	cell communication
GO:0048731	0.944	system development
GO:0051716	0.940	cellular response to stimulus
GO:0048523	0.925	negative regulation of cellular process
GO:0030335	0.921	positive regulation of cell migration
GO:0007399	0.911	nervous system development
GO:0051239	0.903	regulation of multicellular organismal process
GO:0023052	0.845	signaling
GO:0120035	0.845	regulation of plasma membrane bounded cell projection organization
GO:0022603	0.838	regulation of anatomical structure morphogenesis
GO:0008361	0.816	regulation of cell size
GO:0050770	0.814	regulation of axonogenesis
GO:0007165	0.805	signal transduction
GO:0030308	0.790	negative regulation of cell growth
GO:0061387	0.787	regulation of extent of cell growth
GO:0030516	0.777	regulation of axon extension
GO:0048583	0.762	regulation of response to stimulus
GO:0048640	0.762	negative regulation of developmental growth
GO:0010977	0.751	negative regulation of neuron projection development
GO:0030517	0.734	negative regulation of axon extension
GO:0007417	0.647	central nervous system development
GO:0048513	0.611	animal organ development
GO:0007166	0.590	cell surface receptor signaling pathway
GO:0060322	0.583	head development
GO:0048869	0.577	cellular developmental process
GO:0048870	0.504	cell motility
GO:0030154	0.489	cell differentiation
GO:0016477	0.461	cell migration
GO:0009653	0.416	anatomical structure morphogenesis
GO:0009966	0.402	regulation of signal transduction
GO:0007420	0.392	brain development
GO:0042221	0.391	response to chemical
GO:0019222	0.311	regulation of metabolic process
GO:0048468	0.301	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005737	0.988	cytoplasm
GO:0009986	0.416	cell surface
GO:0030312	0.315	external encapsulating structure
GO:0005634	0.315	nucleus
GO:0005794	0.312	Golgi apparatus
GO:0005829	0.301	cytosol
GO:0070013	0.300	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]