StarFunc result for job id Q8NFZ5

User Input

>input (429 residues)
MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAA
PSLVDALLEQVARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHERE
KEVVLLRRSMAEGERARAASDVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQR
NVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVEDLNAKWQRYNASRDEYVRG
LHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQMLE
QQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAK
YLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEEL
LRHVAECCQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFZ5	1.000	1.000	1.714E-56	429	1.000	1.000	Q8NFZ5.pdb.gz	TNIP2_HUMAN TNFAIP3-interacting protein 2 OS=Homo sapiens OX=9606 GN=TNIP2 PE=1 SV=1
2	AFDB:D6RGJ2	0.245	0.290	1.542E-43	346	0.807	1.000	D6RGJ2.pdb.gz	D6RGJ2_HUMAN TNFAIP3 interacting protein 2 OS=Homo sapiens OX=9606 GN=TNIP2 PE=1 SV=1
3	AFDB:Q99JG7	0.323	0.322	2.956E-41	430	0.790	0.788	Q99JG7.pdb.gz	TNIP2_MOUSE TNFAIP3-interacting protein 2 OS=Mus musculus OX=10090 GN=Tnip2 PE=1 SV=1
4	AFDB:Q8BT07	0.239	0.224	4.797E-3	462	0.191	0.177	Q8BT07.pdb.gz	CEP55_MOUSE Centrosomal protein of 55 kDa OS=Mus musculus OX=10090 GN=Cep55 PE=1 SV=2
5	AFDB:Q502I3	0.424	0.419	8.282E-3	435	0.203	0.200	Q502I3.pdb.gz	CEP55_DANRE Centrosomal protein of 55 kDa OS=Danio rerio OX=7955 GN=cep55 PE=2 SV=1
6	AFDB:Q386P9	0.201	0.189	1.879E-2	461	0.203	0.189	Q386P9.pdb.gz	Q386P9_TRYB2 DUF4201 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0210 PE=4 SV=1
7	AFDB:Q8IYM0	0.112	0.061	3.029E-2	893	0.172	0.083	Q8IYM0.pdb.gz	F186B_HUMAN Protein FAM186B OS=Homo sapiens OX=9606 GN=FAM186B PE=2 SV=2
8	AFDB:Q53EZ4	0.204	0.190	7.357E-2	464	0.193	0.179	Q53EZ4.pdb.gz	CEP55_HUMAN Centrosomal protein of 55 kDa OS=Homo sapiens OX=9606 GN=CEP55 PE=1 SV=3
9	AFDB:Q12934	0.268	0.189	9.667E-2	665	0.191	0.123	Q12934.pdb.gz	BFSP1_HUMAN Filensin OS=Homo sapiens OX=9606 GN=BFSP1 PE=1 SV=3
10	AFDB:Q17695	0.191	0.173	1.787E-1	479	0.166	0.148	Q17695.pdb.gz	SPDL1_CAEEL Spindly-like protein spdl-1 OS=Caenorhabditis elegans OX=6239 GN=spdl-1 PE=1 SV=1
11	PDB:4z4kA	0.057	0.086	2.632	282	0.016	0.025	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
12	PDB:3j7a3	0.035	0.130	4.244	95	0.014	0.063	3j7a3.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
13	PDB:3w5kB	0.057	0.207	5.971	110	0.019	0.073	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
14	PDB:1b8tA	0.038	0.069	7.327	192	0.028	0.062	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
15	PDB:3lf0A	0.044	0.170	7.845	99	0.002	0.010	3lf0A.pdb.gz	Crystal structures of the apo and ATP bound Mycobacterium tuberculosis nitrogen regulatory PII protein.
16	PDB:4v96AA	0.065	0.093	8.992	299	0.021	0.030	4v96AA.pdb.gz
17	PDB:6hhqb	0.030	0.129	9.627	97	0.005	0.021	6hhqb.pdb.gz	Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NFZ5	0.0	858	429	1.000	1.000	TNIP2_HUMAN TNFAIP3-interacting protein 2 OS=Homo sapiens OX=9606 GN=TNIP2 PE=1 SV=1
2	Q99JG7	0.0	667	430	0.790	0.788	TNIP2_MOUSE TNFAIP3-interacting protein 2 OS=Mus musculus OX=10090 GN=Tnip2 PE=1 SV=1
3	D6RGJ2	1.26e-137	399	346	0.510	0.633	D6RGJ2_HUMAN TNFAIP3 interacting protein 2 OS=Homo sapiens OX=9606 GN=TNIP2 PE=1 SV=1
4	Q07970	2.61e-04	45.8	793	0.098	0.053	KN14C_ARATH Kinesin-like protein KIN-14C OS=Arabidopsis thaliana OX=3702 GN=KIN14C PE=2 SV=1
5	Q9WUU8	5.13e-04	44.7	647	0.084	0.056	TNIP1_MOUSE TNFAIP3-interacting protein 1 OS=Mus musculus OX=10090 GN=Tnip1 PE=1 SV=1
6	A0A0A0MRZ4	0.001	43.5	619	0.077	0.053	A0A0A0MRZ4_HUMAN TNFAIP3 interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=1
7	F4JGP4	0.001	43.9	790	0.098	0.053	KN14D_ARATH Kinesin-like protein KIN-14D OS=Arabidopsis thaliana OX=3702 GN=KIN14D PE=2 SV=1
8	Q15025	0.001	43.9	636	0.077	0.052	TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=2
9	Q12749	0.017	40.0	1114	0.082	0.031	SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC6 PE=1 SV=1
10	C0H5F4	0.15	37.0	3254	0.075	0.010	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
11	Q96KP6	0.21	36.2	325	0.084	0.111	TNIP3_HUMAN TNFAIP3-interacting protein 3 OS=Homo sapiens OX=9606 GN=TNIP3 PE=1 SV=2
12	Q5TZA2	0.51	35.4	2017	0.086	0.018	CROCC_HUMAN Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
13	Q5RI56	0.75	34.7	517	0.154	0.128	OPTN_DANRE Optineurin OS=Danio rerio OX=7955 GN=optn PE=2 SV=2
14	Q8CJ40	1.1	34.3	2009	0.077	0.016	CROCC_MOUSE Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2
15	Q6X1Y7	2.0	33.5	1294	0.152	0.050	Q6X1Y7_LEGPN Effector protein B OS=Legionella pneumophila OX=446 GN=lepB PE=1 SV=1
16	A0A1D8PN92	2.1	33.5	1948	0.140	0.031	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
17	Q8IDX6	2.4	33.1	3130	0.142	0.019	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
18	Q8BT07	3.1	32.7	462	0.093	0.087	CEP55_MOUSE Centrosomal protein of 55 kDa OS=Mus musculus OX=10090 GN=Cep55 PE=1 SV=2
19	Q8CGB3	3.3	32.7	1411	0.184	0.056	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
20	Q12267	3.8	32.3	1418	0.135	0.041	SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16516 CC2-LZ	4.8e-05	35.0	Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator
2	PF13870 DUF4201	8e+02	11.1	Domain of unknown function (DUF4201)
3	PF12180 EABR	1.6e-13	61.3	TSG101 and ALIX binding domain of CEP55
4	PF16454 PI3K_P85_iSH2	8.2	17.5	Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain
5	PF08880 QLQ	2e+02	13.1	QLQ
6	PF13894 zf-C2H2_4	5.4e+02	12.9	C2H2-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321203

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263056	0.998	Mitogen-activated protein kinase kinase kinase 8
2	9606.ENSP00000441543	0.997	Polyubiquitin-C
3	9606.ENSP00000226574	0.996	Nuclear factor NF-kappa-B p105 subunit
4	9606.ENSP00000481570	0.993	Tumor necrosis factor alpha-induced protein 3
5	9606.ENSP00000304697	0.979	Polyubiquitin-B
6	9606.ENSP00000384273	0.975	Transcription factor p65
7	9606.ENSP00000483825	0.973	NF-kappa-B essential modulator
8	9606.ENSP00000369375	0.966	Angiopoietin-1 receptor
9	9606.ENSP00000359424	0.960	Inhibitor of nuclear factor kappa-B kinase subunit alpha
10	9606.ENSP00000430684	0.960	Inhibitor of nuclear factor kappa-B kinase subunit beta
11	9606.ENSP00000428340	0.941	Angiopoietin-1
12	9606.ENSP00000272317	0.926	Ubiquitin-40S ribosomal protein S27a
13	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
14	9606.ENSP00000295025	0.886	Proto-oncogene c-Rel
15	9606.ENSP00000162749	0.804	Tumor necrosis factor receptor superfamily member 1A
16	9606.ENSP00000324856	0.800	Serine/threonine-protein kinase STK11
17	9606.ENSP00000398698	0.759	Tumor necrosis factor
18	9606.ENSP00000317891	0.719	TNFAIP3-interacting protein 1
19	9606.ENSP00000302486	0.705	Dual specificity mitogen-activated protein kinase kinase 1
20	9606.ENSP00000426613	0.693	TNFAIP3-interacting protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031593	0.998	polyubiquitin modification-dependent protein binding
GO:0019901	0.997	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009893	0.990	positive regulation of metabolic process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0009966	0.982	regulation of signal transduction
GO:0080090	0.977	regulation of primary metabolic process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0010941	0.977	regulation of cell death
GO:0010604	0.977	positive regulation of macromolecule metabolic process
GO:0042981	0.974	regulation of apoptotic process
GO:1902531	0.965	regulation of intracellular signal transduction
GO:0048519	0.955	negative regulation of biological process
GO:0031323	0.950	regulation of cellular metabolic process
GO:0051173	0.948	positive regulation of nitrogen compound metabolic process
GO:0010468	0.947	regulation of gene expression
GO:0048523	0.944	negative regulation of cellular process
GO:0048522	0.944	positive regulation of cellular process
GO:0009889	0.942	regulation of biosynthetic process
GO:0043122	0.938	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048584	0.934	positive regulation of response to stimulus
GO:0043123	0.923	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0031325	0.910	positive regulation of cellular metabolic process
GO:0010556	0.907	regulation of macromolecule biosynthetic process
GO:0031326	0.905	regulation of cellular biosynthetic process
GO:2001141	0.904	regulation of RNA biosynthetic process
GO:0006355	0.893	regulation of DNA-templated transcription
GO:0060548	0.876	negative regulation of cell death
GO:0009987	0.869	cellular process
GO:0009891	0.860	positive regulation of biosynthetic process
GO:1904035	0.846	regulation of epithelial cell apoptotic process
GO:0050896	0.842	response to stimulus
GO:0031328	0.822	positive regulation of cellular biosynthetic process
GO:0045935	0.801	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.775	positive regulation of RNA metabolic process
GO:1902680	0.772	positive regulation of RNA biosynthetic process
GO:0045893	0.755	positive regulation of DNA-templated transcription
GO:0006357	0.747	regulation of transcription by RNA polymerase II
GO:0051716	0.740	cellular response to stimulus
GO:0045944	0.678	positive regulation of transcription by RNA polymerase II
GO:0007154	0.624	cell communication
GO:0043066	0.622	negative regulation of apoptotic process
GO:0023052	0.604	signaling
GO:0007165	0.570	signal transduction
GO:0008152	0.438	metabolic process
GO:0071704	0.433	organic substance metabolic process
GO:2000351	0.381	regulation of endothelial cell apoptotic process
GO:0042221	0.361	response to chemical
GO:0043170	0.352	macromolecule metabolic process
GO:0044238	0.321	primary metabolic process
GO:0010033	0.319	response to organic substance
GO:0006807	0.316	nitrogen compound metabolic process
GO:1904036	0.315	negative regulation of epithelial cell apoptotic process
GO:0065009	0.314	regulation of molecular function
GO:0009605	0.313	response to external stimulus
GO:0071310	0.307	cellular response to organic substance
GO:0051239	0.305	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm
GO:0032991	0.429	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]